Powrmatic Space Heating


Shown below are boiler manuals. Click on the manual to open it. Alternatively right click to save to a custom location. The manuals title will indicate if they are installation,user manual or other types of manuals or resources. In due course we will provided the ability to search on multiple terms and by GC no.
%PDF-1.4 % 1 0 obj << /Type /Catalog /Pages 2 0 R /PageLayout /SinglePage /OpenAction 154 1 R /Metadata 157 0 R >> endobj 2 0 obj << /Type /Pages /Count 4 /Kids [ 4 0 R 5 0 R 6 0 R 3 0 R ] >> endobj 3 0 obj << /Type /Page /Contents 9 0 R /MediaBox [ 0 0 595 841 ] /Annots 7 0 R /Resources 8 0 R /Parent 2 0 R >> endobj 4 0 obj << /Type /Page /Parent 2 0 R /MediaBox [ 0 0 595 841 ] /Annots 23 0 R /Resources 24 0 R /Contents 25 0 R /AA << /O 155 0 R >> >> endobj 5 0 obj << /Type /Page /Parent 2 0 R /MediaBox [ 0 0 595 841 ] /Annots 37 0 R /Resources 38 0 R /Contents 39 0 R >> endobj 6 0 obj << /Type /Page /Parent 2 0 R /MediaBox [ 0 0 595 841 ] /Annots 50 0 R /Resources 51 0 R /Contents 52 0 R >> endobj 7 0 obj [ ] endobj 8 0 obj << /ProcSet [ /PDF /Text ] /Shading 10 0 R /Font 11 0 R >> endobj 9 0 obj << /Length 5694 /Filter [ /FlateDecode ] >> stream x\M$q/XO$2iٲ .̃`8=;CIց@`E@ʌQ K?q//$R;<򅬽J]勚5նDۚz")sC)5[k )u%.5K)H쫈,嵗1%Жڰ,<`7A:J-GxČ0{ט.׬hMkK2,e%mwL BXs<'3(k͵nhTR@߾|7[_?ۛo']n XG~=poeFH5-԰*m=Eo h%R} @[%t%cI1ف'2ḥ볡$ le@z%P$œ6]Q+**=<ѩg< 7*R5~0?Hq-ܰGRpM_kb@}Q:;*/H|x]ӫ7_?}_~gL' |{_n^/>sзˇwkxuxww?=/oYMlX;\BLۀ.f3|x-INPy~*(=z)ކy:ޭہ2LV?ݽe5wO;i{7,7>|X/~t͇̂G~|pۧo0ow맻wwϿ_~[0Ϝ|ۛo~|LOǧۻ$T0̵DP_kB6iI0W:%!)aA/sH@Yü D#fC ]pQԙ]<CȤ} NV|̗N:(Ο*/G,j},UxXw.HKycrz.봰z$,ٿBNq$km?9K N!`)*2<.7R0h/XQ=dʠ+&)BY#U&h.$"j"c`ū}TjSmԹ ^u oǗ}y'ȫJ.'{NeG Aښ8F6V˩`r[6b׋CR܉Zy1;Vh\\R@ИR7`fțT ?*+hn_[G72Jg(fko}!ׄkԡ<4D /JǠnEml-jHcz&wKqM%V#U6Psх "HjĖVqH'tk& S+U%Z0J@ר]5\Si5@W[,z,⤮ӘhG.ZRT]1#ÂZke2QBnà#$b${4H ǜ6_y/Ɛ۹n >, Dz^!_@Y`H|IWJ%uϨ8Rڂ $b3,Z21l!Ab ب KH=NMT͠ZU7&]4z?IJj\!PR⯍QUoy:cpS( scz8GL$0o4Zn;ȭC[IkP5wH#9ݶsTh |.|,h2r9(mfBAף^҈*YBTE}-^hڋHc,hˠK4KbB67ZDvk#k$,s@sDteVֿ`Yi&Ɍxݐ\˅Q{K(Y ">zV!T핬v+RLsd^*wnQ נt*J=NUQ}Fr2w ߊPP| xK֝+IU%CIfK&> A1JEPo#o82\ iRubXnq՘MQE^yAJ5;P 6 fPʉjhtDdd.fCnCO{H3-Ηp! F>wGNt'K@-^GҎEڽi34SY;r{T Gݍ>g{ ;pp!E/22M[usHbWdudR^%^tiOƣxh١LHDИB-BAڽ'` &S̅h\/lQpC-c?9~PW{W48ݢ;!?M xJEbX{D/+;rΚ=[BGkZ^'K;Yi5Y;*J(9cFV& ))=}Gʸzu !uGWFkBt\xxW RԂ#Y[]$ 'd*svk7 N'?L҇0߳чS],'%\ 90`8]BF̺bt, wm>rC[hiqhL@^xZ htB'DA ֣Ӳ%4"cɝمU]ՙ]2P<:۴ˎtvNrcRЛL r&0(u'r7-ۡ虧-F.!ٺ5Ew(!đrxҵ՜;\1(HFEZlp͑4<-F#2/ARwIy;l&htz)a{lbJ YjV%9i/, M,84_?XPTBsFM^K ?@}ta=Xð :nIT~:TS6]'F|BM&3rvRd֪Ʈ+6vЭ- &&mFv>nF!7nHQɱ;*GIKު&~<tGL5m~6Ks)D< " lm; tƭ|E`~qɡdߺZp"!`^Do`);QRsR34YZP6g ,92b7ofp'7:6-ioؖ'_R 2maL62ha U}\!m֕jqjO2$qe鈋Ab;84!(gO/}a:CA"$4,lwes^VNߘ'MӦ/g cIB2|!6y[*F ϸ6JHn]Ou(ũI¼K?AyI:C=s9[g..7-V|'18EU? kmEv :dž&bP&"Z@hVvDB)1n< 6?tlE#D\-# 8k+#5rGoyv-jh3 ]ˡ^򽶠?OY endstream endobj 10 0 obj << /FHShade0 13 0 R /FHShade1 14 0 R /FHShade2 15 0 R /FHShade3 16 0 R /FHShade4 17 0 R /FHShade5 18 0 R /FHShade6 19 0 R /FHShade7 20 0 R /FHShade8 21 0 R /FHShade9 22 0 R >> endobj 11 0 obj << /F0 12 0 R >> endobj 12 0 obj << /Type /Font /Subtype /TrueType /Name /F0 /BaseFont /Arial /Encoding /WinAnsiEncoding /FirstChar 30 /LastChar 255 /FontDescriptor 56 0 R /Widths [ 750 750 278 278 355 556 556 889 667 191 333 333 389 584 278 333 278 278 556 556 556 556 556 556 556 556 556 556 278 278 584 584 584 556 1015 667 667 722 722 667 611 778 722 278 500 667 556 833 722 778 667 778 722 667 611 722 667 944 667 667 611 278 278 278 469 556 333 556 556 500 556 556 278 556 556 222 222 500 222 833 556 556 556 556 333 500 278 556 500 722 500 500 500 334 260 334 584 750 556 750 222 556 333 1000 556 556 333 1000 667 333 1000 750 611 750 750 222 222 333 333 350 556 1000 333 1000 500 333 944 750 500 667 278 333 556 556 556 556 260 556 333 737 370 556 584 333 737 552 400 549 333 333 333 576 537 278 333 333 365 556 834 834 834 611 667 667 667 667 667 667 1000 722 667 667 667 667 278 278 278 278 722 722 778 778 778 778 778 584 778 722 722 722 722 667 667 611 556 556 556 556 556 556 889 500 556 556 556 556 278 278 278 278 556 556 556 556 556 556 556 549 611 556 556 556 556 500 556 500 ] >> endobj 13 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 0 0 0 0 65536 17694720 0 0 5 0 0 0 3276 0 0 0 32767 0 0 0 65536 15933 44492 59523 -65536 -65536 -65536 7143521 15 ] /Coords [ 758 3667 758 3196 ] /Function 72 0 R /ColorSpace /DeviceCMYK >> endobj 14 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 65536 0 0 0 6553 17694720 0 0 4 0 0 0 65536 0 0 0 32767 51106 58020 -65536 -65536 -65536 7143521 ] /Coords [ 358 3478 358 3196 ] /Function 76 0 R /ColorSpace /DeviceCMYK >> endobj 15 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 3276 0 0 0 65536 17694720 1 0 5 0 0 0 19660 0 0 0 32767 0 0 0 65536 13528 22546 44191 -65536 -65536 -65536 7143521 15 ] /Coords [ 518 3953 518 3482 ] /Function 81 0 R /ColorSpace /DeviceCMYK >> endobj 16 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 0 0 0 0 13107 17694720 0 0 5 0 0 0 655 0 0 0 6553 0 0 0 13107 15933 44492 59523 -65536 -65536 -65536 0 1237664 ] /Coords [ 758 3667 758 3196 ] /Function 86 0 R /ColorSpace /DeviceCMYK >> endobj 17 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 13107 0 0 0 1310 17694720 0 0 4 0 0 0 13107 0 0 0 6553 51106 58020 -65536 -65536 -65536 0 ] /Coords [ 358 3478 358 3196 ] /Function 90 0 R /ColorSpace /DeviceCMYK >> endobj 18 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 655 0 0 0 13107 17694720 1 0 5 0 0 0 3932 0 0 0 6553 0 0 0 13107 13528 22546 44191 -65536 -65536 -65536 0 1237664 ] /Coords [ 518 3953 518 3482 ] /Function 95 0 R /ColorSpace /DeviceCMYK >> endobj 19 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 0 0 0 0 65536 17694720 0 0 5 0 0 0 3276 0 0 0 32767 0 0 0 65536 15933 44492 59523 -65536 -65536 -65536 3276 3276 ] /Coords [ 262 3305 262 3269 ] /Function 100 0 R /ColorSpace /DeviceCMYK >> endobj 20 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 65536 0 0 0 6553 17694720 0 0 4 0 0 0 65536 0 0 0 32767 51106 58020 -65536 -65536 -65536 3276 ] /Coords [ 232 3290 232 3269 ] /Function 104 0 R /ColorSpace /DeviceCMYK >> endobj 21 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 65536 0 0 0 0 17694720 0 0 4 0 0 0 26214 0 0 0 0 19841 56517 -65536 -65536 -65536 3276 ] /Coords [ 273 3326 273 3305 ] /Function 108 0 R /ColorSpace /DeviceCMYK >> endobj 22 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 3276 0 0 0 65536 17694720 1 0 5 0 0 0 19660 0 0 0 32767 0 0 0 65536 13528 22546 44191 -65536 -65536 -65536 3276 3276 ] /Coords [ 244 3326 244 3291 ] /Function 113 0 R /ColorSpace /DeviceCMYK >> endobj 23 0 obj [ ] endobj 24 0 obj << /ProcSet [ /PDF /Text ] /Shading 26 0 R /Font 27 0 R >> endobj 25 0 obj << /Length 2541 /Filter [ /FlateDecode ] >> stream xZMs7JG)a4>sceM-&:E-Rk3*T#intH -s|ǟtx撓&88#4dubq8d#o7>sHRb4H gtzAFKNF1/UPV,xbˏsZx%VFiF:UeY}.$#Vؗ"-n dmV4jMEo3T1%ouvĢR¾FmRJڀuF+zM[Tg1@o+㣿fJnĻg خCHq!⽹`z[J*OA訤# a/xb4Je} I:)H>dM6bñ #,;QmScUydx@uv~ӪFI6h%MdMBL>㺏g5p:#;%Gh"Y(1MS;WVgBa65QI ر0DH"eNJ0E;YDbJFqu^:X 2A`QlS ,yBְ7EZŸ~Pj1ύl4 m#<-ǽqGpK[z{료u/f>4;8_`/\D97)6_V$(CGz:r†>Ȩ`Mpr0Aې r›gsހFdFU?U NbziĂbpZv41HLK9!kgD芈*ꉃE`=;\XJeUU\kX.+| M益!>TMoPUS6QMulE}U*UUԇhX5}T*zm%oQ% u%}ZNgc3Ë́AUχz>V=@ty z o\6y;烣F?[|+7UsPHҁ{ O6S;f*5U7]A^3Hw[*[/ݩ:N*C"tlJwF*FJwN")E -"+,);_Keyc 秽ԳC`TΕ6m_u@:mzmG Eq\P7UkEqJVhPԀ,mV= < 4pDyc kz2*m_B_Rpg*LۨgIkF]IB{~x\orb6Zb x@I4-GHbv[l|;b-MĬslgPz5jUL&q:P␹Fٲn?_%̛?nyX?e39Pxsg]w7)HNfѳ5Q8C(SZ̤bYoEṁ m6Ә;x=*hך(FV9]|1lvo2h{{LSٝ9]xyYhxzmo_r*ΈJe^ruDuSބtv]y3$~62;MTZx >dҔ=pLNijshٞ]_ɽm)76I^,wL7[/⫘~yۉGicn'ū͗ˉNDy~+6%&/~0c],oswۭߋ/BHx >/?y ~n\䜲_+-7[엋9vC"Y~/|pT}8AFJpy)Ɠ18$J7zijWHqE ٖGXy3=H,Og+sobC;rd]*!ZVG:X`tя\Z:z, ?ǡuܙj ja\!Lu_TlKf(ԡP|"_QFhʮBK87 aZ6 Goej>GSˋ:bÓ[]砷" D.'h$~4w$0Ԇdj!%0jd6B'\paf ~(Q5MdW'C1I&: obhë)P"~:a%nt5HkUN^>K=o1)AO2'D|d ңW 8֒q}S87?^׿^ċ qq~(+W/?8No( endstream endobj 26 0 obj << /FHShade10 29 0 R /FHShade11 30 0 R /FHShade12 31 0 R /FHShade13 32 0 R /FHShade14 33 0 R /FHShade15 34 0 R /FHShade16 35 0 R /FHShade17 36 0 R >> endobj 27 0 obj << /F1 28 0 R /F0 12 0 R >> endobj 28 0 obj << /Type /Font /Subtype /Type1 /Name /F1 /BaseFont /Helvetica-Bold /Encoding /WinAnsiEncoding >> endobj 29 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 0 0 0 0 65536 17694720 0 0 5 0 0 0 3276 0 0 0 32767 0 0 0 65536 15933 44492 59523 -65536 -65536 -65536 3276 3276 ] /Coords [ 758 3667 758 3196 ] /Function 118 0 R /ColorSpace /DeviceCMYK >> endobj 30 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 65536 0 0 0 6553 17694720 0 0 4 0 0 0 65536 0 0 0 32767 51106 58020 -65536 -65536 -65536 3276 ] /Coords [ 358 3478 358 3196 ] /Function 122 0 R /ColorSpace /DeviceCMYK >> endobj 31 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 65536 0 0 0 0 17694720 0 0 4 0 0 0 26214 0 0 0 0 19841 56517 -65536 -65536 -65536 3276 ] /Coords [ 898 3953 898 3671 ] /Function 126 0 R /ColorSpace /DeviceCMYK >> endobj 32 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 3276 0 0 0 65536 17694720 1 0 5 0 0 0 19660 0 0 0 32767 0 0 0 65536 13528 22546 44191 -65536 -65536 -65536 3276 3276 ] /Coords [ 518 3953 518 3482 ] /Function 131 0 R /ColorSpace /DeviceCMYK >> endobj 33 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 0 0 0 0 13107 17694720 0 0 5 0 0 0 655 0 0 0 6553 0 0 0 13107 15933 44492 59523 -65536 -65536 -65536 0 1237664 ] /Coords [ 758 3667 758 3196 ] /Function 136 0 R /ColorSpace /DeviceCMYK >> endobj 34 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 13107 0 0 0 1310 17694720 0 0 4 0 0 0 13107 0 0 0 6553 51106 58020 -65536 -65536 -65536 0 ] /Coords [ 358 3478 358 3196 ] /Function 140 0 R /ColorSpace /DeviceCMYK >> endobj 35 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 13107 0 0 0 0 17694720 0 0 4 0 0 0 5243 0 0 0 0 19841 56517 -65536 -65536 -65536 0 ] /Coords [ 898 3953 898 3671 ] /Function 144 0 R /ColorSpace /DeviceCMYK >> endobj 36 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 655 0 0 0 13107 17694720 1 0 5 0 0 0 3932 0 0 0 6553 0 0 0 13107 13528 22546 44191 -65536 -65536 -65536 0 1237664 ] /Coords [ 518 3953 518 3482 ] /Function 149 0 R /ColorSpace /DeviceCMYK >> endobj 37 0 obj [ ] endobj 38 0 obj << /ProcSet [ /PDF /Text ] /Font 40 0 R /Shading 41 0 R >> endobj 39 0 obj << /Length 8491 /Filter [ /FlateDecode ] >> stream x][6r~W+hb;7[8jGglጎ=ݸ6dK:oF/DwMXǗ/I5Se|h'|zh ,l; fleo ?|q~wIؾc@t1Zy,[7^؉ջ^}Y/>87=~N|[s)M_6btُ)u%Qx3rnmiܼaߎxnᱹ^.|/~ؽy~SsNOЉ>/7p|8:9~2ߵP:d{WRuv=Oa+aabw/zE.qnN>8>9鰟q\y?A?n~`>gtA3ҕ>ܰ4moG5{}~>8QgGL;#8ALzo菨p:+<A aY ,>M ֛v̙51}7e{GftK_4~@罏|1r]P`tw17R43 ֏|Nџy_3@??4Vt1tGg%i|pܻ8!4\}GZ4'drA>B|Ϥw1zopk](\ m@vvnK53x8yxsg#zY}X+'g rޝ}XG8 \u8/4IR0>!nsnPDA:f0l{gô?QR gmqb LBNsnّ=%Z0j~|ڀE.w^\vCx [S5 N4tVrZ!.f~g~=N Sv +>ikpHax5}S^?޽ ')|7Ϩ6!]iPhvq*}˹r\B+ 5d{3YiVepBrm&:?7߿b9ÑZ^mo$ӵjPTN0zn4('2c*x+Ч.:>ŠwVp0IgӘ(9[s/u ýʁG(4\vJ)BA0Nk<*t+IMsn7߼a\u5phEV+&7HjOD#;~YDE@x [Z>TQUBy)ȵ bwhwz&r480;D cC.X:3|oN cLmD&ASE"\503qFh eeKyqx25nq(6őG ;`xiAb|10D;gb6uRb!LQDb40š+x'{s0R Qˆ8ÅaByl&_p1D ]zp9#cQ=~>`x CL䲁diL7ְpm1|kdZa5' M(PjH_ H\4HUy>nkf_G!hO/I{tR8l3H'$ 9X. bўRD qO`]+L+ `" yרP89H߸N ;st\%HUh??]aD+IS֩U0d9e4V(arف1GI@2ֽ`sFXJ_,Fڭ=$c; [+d~HFY %0ս (1+p0$&7}g03)!IG ZX"60&`Y,rm$u!|Ā. ei/<(`N+0w1| ĹUj"\+#k@Ҁ- YxQ\ GSɺT1 SUJ0L No~у]G_ &X(<#.Q1.4pƹjf mߊe|qHgk-E epƹ2 X`gk9&㜒IF+3&f<L2.ɭ֥@6@yVm?Wr**( :p&~M{*2d@) 2pƹg>qu8\^ :0(]oEW^yFRHgԴҒZS)\{dX(gb3yR#~cv*N`r%0ھclP6pݠ30Ƌ_c aP-(D201BKd2ED&SZjL -- %%QhR-]BK'J"MRyn"5@U "[T(lSB?$BRY(DZ  Y*"[TEdɣ:";yȯTI׉BK$wR-Yh`% -U)YZ";TKd_iZ";n:M/D<|j. -54YCZ"$TKd Z";ᅖȯTK׎BK0ՃWy]ZJ 2-yg ٝ)dZ"{]b\KBKA%Uz~s"l}$C̺-L #o&=f'4Ov<8G=,{U<@sB/҄ˡy XGs^`tS%g6Y~MC?BygA>G))!xtP|gH-PXG R蝪ѓ&-+~sT yO!?Z<={hvNӃo Dґq,Jp@FC0?ZW pu ߤ/$j`$}5p j5Sv7I{`. /Y*Or-iUW uޠ]VH `%;r{}|`,݀cqjdA=\KXKN 8Y KI yC޽l1&0!Ϫkz`kIM;`~.o ƪ`L%Ӧ$խZʷYv^I\"2Q kFa/]rA,/ _C)u /aE Cݧ>;F@Dp.zxɁHB=s9ė4^ڀ{»I H̍ـ?9cz*T=Ļ`*8|U5\ޕ}1W„d+C!0aA(g;˟N@j), +]##y&nKlތ Av[ CQ5^6 o63tYF`r ].JSo&GSɺޛqOHs{(J=fE\ě[?WYHLX#$1!MM~Fu Eg 8P;vJMᢁ nDҠ#\ĥVRIW3 'D+Sd``(|S< Շ(Tޠ{g^.L+µ$ϲ"-[io,vo]W_U Vj3o[~;]L] S"Bᵫ2{|Iqa Z-ﶸ00rBS:.XŔߍOSzy~}i޽mߑ>>[&8v;{?!0h7U^/ݥDTQ_xnk/;7t\_ ;VFHosŰk5^.tW0A߄Wj+NZ͉FtCϗuRp};\\kTv;G{%gnO_^ge$l?Z5gH3h ne~ݸK<ޤyY( nN) ^Ȋ!wsBG nH8A@v-mR] B@"A~7)j8D5!kݶsF< ?sףWWJZ#jQ01&tah@WBOО>"/,3^-L~€D{5 <2’h[JPkJHwn+!qZ*_ HI0L "J W @5-uSHײnk!^ZhU-5[`bE #Bx}Yу0z0]E{k%8Xp/ſχf>N3$>-X%p\nQxguZ45i7\-6؆+ Χ f̐.צg.[&eEr+#9zD9 u=ƂW IEd{FrxcEЅr hأ&\ʪ!ou!ҡ P6o~RaD0m p'd(%Ke g|iOhȝ0)a@(*$_0m`oxReƛ`Y{{a&< "y{)C{ ޴}?L;L,.'|˙V ihsQ !Bi|S-bynUBR jƹt5b˖W=5O5hpp!s[8r6ӧe5Vdh.͕Iq{dYY3f0oJF9 *Z.ƞ|%ҏ0+y;:WmiP @K(bՏչ_`JtN E O(}b%}A =قPXV̕:ZeczZ/m |òy%nBKZ=]/7Wm$Ua\'Wm\av^p~GWM0qv9A?Fxw7"l8ُ?_mUNٸmU:Ɯ-q *]\\l=j`ō@@l)0IT[- kfK`ٿv WK.:u{a A:~_h*}}1R^3V`@#|ggV:ɖԍ!)aFS_NWZQ"FrbPǏNVZ 賫`ԆcfNES5Gb-> endobj 41 0 obj << /FHShade18 46 0 R /FHShade19 47 0 R /FHShade20 48 0 R /FHShade21 49 0 R >> endobj 42 0 obj << /Type /Font /Subtype /TrueType /Name /F2 /BaseFont /Arial,Bold /Encoding /WinAnsiEncoding /FirstChar 30 /LastChar 255 /FontDescriptor 58 0 R /Widths [ 750 750 278 333 474 556 556 889 722 238 333 333 389 584 278 333 278 278 556 556 556 556 556 556 556 556 556 556 333 333 584 584 584 611 975 722 722 722 722 667 611 778 722 278 556 722 611 833 722 778 667 778 722 667 611 722 667 944 667 667 611 333 278 333 584 556 333 556 611 556 611 556 333 611 611 278 278 556 278 889 611 611 611 611 389 556 333 611 556 778 556 556 500 389 280 389 584 750 556 750 278 556 500 1000 556 556 333 1000 667 333 1000 750 611 750 750 278 278 500 500 350 556 1000 333 1000 556 333 944 750 500 667 278 333 556 556 556 556 280 556 333 737 370 556 584 333 737 552 400 549 333 333 333 576 556 278 333 333 365 556 834 834 834 611 722 722 722 722 722 722 1000 722 667 667 667 667 278 278 278 278 722 722 778 778 778 778 778 584 778 722 722 722 722 667 667 611 556 556 556 556 556 556 889 556 556 556 556 556 278 278 278 278 611 611 611 611 611 611 611 549 611 611 611 611 611 556 611 556 ] >> endobj 43 0 obj << /Type /Font /Subtype /Type1 /Name /F3 /BaseFont /NewCenturySchlbk-Roman /Encoding /WinAnsiEncoding /FirstChar 32 /LastChar 255 /FontDescriptor 60 0 R /Widths [ 278 296 389 556 556 833 815 204 333 333 500 606 278 333 278 278 556 556 556 556 556 556 556 556 556 556 278 278 606 606 606 444 737 722 722 722 778 722 667 778 833 407 556 778 667 944 815 778 667 778 722 630 667 815 722 981 704 704 611 333 606 333 606 500 333 556 556 444 574 500 333 537 611 315 296 593 315 889 611 500 574 556 444 463 389 611 537 778 537 537 481 333 606 333 606 606 606 606 204 556 389 1000 500 500 606 1000 630 259 1000 606 606 606 606 204 204 389 389 606 556 1000 606 1000 463 259 833 606 606 704 278 296 556 556 556 556 606 500 333 737 334 426 606 333 737 333 400 606 333 333 333 611 606 278 333 333 300 426 834 834 834 444 722 722 722 722 722 722 1000 722 722 722 722 722 407 407 407 407 778 815 778 778 778 778 778 606 778 815 815 815 815 704 667 574 556 556 556 556 556 556 796 444 500 500 500 500 315 315 315 315 500 611 500 500 500 500 500 606 500 611 611 611 611 537 574 537 ] >> endobj 44 0 obj << /Type /Font /Subtype /Type1 /Name /F4 /BaseFont /Helvetica /Encoding /WinAnsiEncoding >> endobj 45 0 obj << /Type /Font /Subtype /Type1 /Name /F5 /BaseFont /NewCenturySchlbk-Italic /Encoding /WinAnsiEncoding /FirstChar 32 /LastChar 255 /FontDescriptor 62 0 R /Widths [ 278 333 400 556 556 833 852 278 333 333 500 606 278 333 278 606 556 556 556 556 556 556 556 556 556 556 278 278 606 606 606 444 747 704 722 722 778 722 667 778 833 407 611 741 667 944 815 778 667 778 741 667 685 815 704 926 704 685 667 333 606 333 606 500 333 574 556 444 611 444 333 537 611 333 315 556 333 889 611 500 574 556 444 444 352 611 519 778 500 500 463 333 606 333 606 606 606 606 204 556 389 1000 500 500 606 1000 667 333 981 606 606 606 606 204 204 389 389 606 500 1000 606 950 444 333 778 606 606 685 278 333 556 556 556 556 606 500 333 747 422 426 606 333 747 333 400 606 333 333 333 611 650 278 333 333 372 426 834 834 834 444 704 704 704 704 704 704 870 722 722 722 722 722 407 407 407 407 778 815 778 778 778 778 778 606 778 815 815 815 815 685 667 556 574 574 574 574 574 574 722 444 444 444 444 444 333 333 333 333 500 611 500 500 500 500 500 606 500 611 611 611 611 500 574 500 ] >> endobj 46 0 obj << /ShadingType 2 /FHGradSize 11 /FHGradStruct [ 2 0 0 0 3276 0 0 0 19660 11796480 0 ] /Coords [ 1726 3835 1712 3835 ] /Function 150 0 R /ColorSpace /DeviceCMYK >> endobj 47 0 obj << /ShadingType 2 /FHGradSize 11 /FHGradStruct [ 2 0 0 0 3276 0 0 0 19660 0 0 ] /Coords [ 1726 3835 1741 3835 ] /Function 151 0 R /ColorSpace /DeviceCMYK >> endobj 48 0 obj << /ShadingType 2 /FHGradSize 11 /FHGradStruct [ 2 0 0 0 3276 0 0 0 19660 11796480 0 ] /Coords [ 1726 3842 1714 3842 ] /Function 152 0 R /ColorSpace /DeviceCMYK >> endobj 49 0 obj << /ShadingType 2 /FHGradSize 11 /FHGradStruct [ 2 0 0 0 3276 0 0 0 19660 0 0 ] /Coords [ 1726 3842 1738 3842 ] /Function 153 0 R /ColorSpace /DeviceCMYK >> endobj 50 0 obj [ ] endobj 51 0 obj << /ProcSet [ /PDF /Text ] /Font 53 0 R >> endobj 52 0 obj << /Length 13515 /Filter [ /FlateDecode ] >> stream xڤ\YsG~WC>fo,%HcBa7.+ͬ3)96UYYYyT%:OXO`Rj\w*fW ٭>J^:T 0=SBx"zdɷ癭{aR? ]do4Vvߋ[ޝ_>}xyr'/ 7@RuwOi7LjXz 8O8O;J{JR3է?S}=ZLCZd=ct+P諢PzTg7OTeG|Q5Z1izm 8SYcHXfƤvZYEeq,){jT/0FT]Ǵh'i y  N`R֩ bt'ӣKtB&T NpOToꭗc  lvlIaJDXJ;:kԲp1nQ0Ee1A౅ %Bq lD,Č'@Ed ho\" h# {%4Yě't!_Lc<]7~N4Yڅ'B:WM <)>.WLd]8Oa"#NT#<0 C -L/Mw(`3lӹ꽍 pT4B`i8} C IP&SL5g,L֡UJXU 4ݸvXlG -\Wi[ ? Gjh Lzt CDA~^NN9nׯ߼~yv?y˧O3޼~3 7098ś_ ӕX<+G ű9Ƃ1qcs2:(l~8S(補bAY5NMV7 P[kzG@)R,m;!GH!\:OΨ뻆&]9Bv ̒rS1+/ѠDtsbP.`\i-p5Va:=*=-I c"Lıƴ'lό֡UJHvrQiCn =WP %j4 'LI٘9C-IՋQ=jWOX6(Z$d_$ `T$q|M%ͫtDspS:)?C'lN"O౞ ʎ0c|A05!E4eTYN&-aOD%e<o[G`nZ^o'`ZӞ/jk0ɦ hAP~re )'0, JǢD-&6Va`0.ޡRz9$ Œ= : `Up+@O *ԊBH&|;R XZ;OxQș5.U$Y'x"QsTlcj|1HӽzKDd@ ? )jݤU"L!=_0/^ЇF#14^8$T"< 0]hvۗ8,T9!|o?xb]^EfLv2ޅb $^.Cs`BXϾ>3EB-IjZ*=B%>۵𖑱U3ۡ I PGٮUku`; }F:S:/P J+C q8[T:ӊo@*vC@,jnf^i211N&@~ϱL0E27^5G d9nJ֑' | QQ***TEVE5*DE7%%X*a&P;N'tannB@>@&OM d'&&x V#>Tϱ3uo(ñh7[(j["D%cl~J%+/5YbǦцwxIѱAԘ3 ǧb YvT/&vGnf&vB&@'[d>O+iSdNtPeN24 UvBa:ḇxi '6ۣ]C҇k1A]O+GLx}+{r=PwuL;|jL ƅ#j7Gxla=iu KP=`KvKeHt!x{H Yޜ@ "Z qe5í Ci[D(8 3C*z"Ջ_<{I4銇/h9Cø'آ ,=6QInשx}ُκS^/~嗗'_Z-{cYw'}3_Y!!ٿ/a?kU&e289=c ^cR6Kl"\bB2'Jh^Axla)9„W[= {&cݗwp!xT|9{|lKw߿\,O9xꌶ5[6(]GwfO>)g-{qek~,hة,@ Lٷ)ۏi&;b $= Vz lejϦ}\$U&=T7`烰ZL/z 1FCt"6'9|I',{k_P %Iz0Ӥ L N/3e(< pKx&|}6\xڪkVqnZMxlaxLǐQ@ M;#o6/v0 ۽ J|98@7!Wp\a_m=~ӆ.U;3YR3#l{ M@)/8oX06O)fX.笅Akb =>2F ;(BB}lƢN,%w <&D< )k'8{5]v(X֛wzOBăϸln}@J4DuϗH.ⷫan<[c?v}wmn؀Y^~Bkf\NDzN+0\nwC`._g~,z 2b趗aۭib C`"82/}VS.uf\.7j{;^tM_F+_"[!Hu%[] ?31X`Ag/a u Nmf] ]}wA7Utgw E< "p g"&f(; f~wn w{6*70V+65uv%@7n8ʵXoVk=a;Pվ6nYkZ }Zo0Wہm/wk]|8$L 8(.~ǍЍ$u|7-CY@MPqb¨~nWϾ{kJGt[c\e ov򢣄w|._ap,w q_t A}Ѻ0=FIDrυ< /=9xwߜ~,7xW'*]vb%޵8`sSmbݷvQb /yN.iz%aJd? Ay!-G\°ln=CP}bauGl}9w N/qKcy#ȼA**3gtqh3[6@(L)^NC#"3\.]^I!8$6]x?"{)V7MNAԻ-)}&-?!fS6©AfS].6n ;O5tuv¼ KI5H}\zn ]/8U^-a){"}*TͳE4?jҚ!dC Jȯ KR}t5:r/W܅,ZdkKUf.V&ԑ8k:Bw*I4 +V$+b,ʃG#F"<\o_XUv+f-5M0 \lLa;$GCRؐ3T*=!L 7[D:!?)וi_>)f cF-0ru/R^ܛ֝ Vu~Fާ?8Ao9Q3G~X[+! $`grTIpqs4@qQ8U\ЬI8qчA ~p `Օ|׼S-tݛ L})ǟ-\Çtt>0 y˶,ຠ bs- V>w>|%)WpZ l\Ζ: l(/ a̩%(ǵMTwSE‡cr0lRδsH g ]vDU1TSR9"|#qxtn>\ aaP$2iI}yve 1QnApmAXMkl1;gh L H8P4[/Z\pc ж؄=>-Rct.a1 fK_.EuR1DoTrGOI ?Uu l`Ljec*=]HъS(Y u!CX\.I?I y $s48m2 _/4 -)&Rctfd8ÈY-}aPJ=A$uZ)M=BoV a̝p]V#gqKB`MDŽ)c4rb+ֈ*'1ך0FJ-^%r2o_ 6Ss?xn o Ŭ Pƚ8fݽ:?,Uv9 ߔ!Βb_=/#x(VD-"N=V ygN[:3D]~p*ԓ)|A7tdۼKOT}(B}MČBXXkEwa>l49DVLGgN?W2m c$Fz v3&⚊Uo j|3Cthm@M[hȰ3M1=gݮ>3DLS3|fy{~VpVH XӇ-[∻| >y湌1I\]N,c(f mM-1ŏܛ c汩$sDiSX Gf, `DQF eIX t&ix *\-FpSy&ka}//€xQQ@87;'$[eU\]Ah̦A2 TX91'.YצEY8O; j\*i™ FcanLMnvĞ)l3OFU)b8+= j NXn)MdR>ތmJ̈FV3]!éBbo5T)!.Wm&!W;k|aۘ!IɉHL mذuFdWkdW_nla A_XprB4HmD<(^ %%""owG בֿU/9sc w_VZIU,]U?,?A2!ڸR?EVrHl/b>'Yҫ&9 6 і3qr'W!"Uǚe#!)`+g\ty|pHx'x_jХ>6!SmKѿϵN_UJfTJYPQtMn4 +`/n$ ASJL hR鏗o'BXg=ZY }KAͥ𽥠dRP2|s)(O7LSI\kH5QC ^B7H7q @"K^Wt7]+$B-a˜ WGЃ27Ŀ` F٫ WE<U1U1e'*)"FĕQ:]]p4>yI1gTTA"}y<%Ԥhj#Btl7lb8}3EsoVY5E9(ҽR gW} [v^BE7Xʙ"FI6Ӛ:qd0ş8 LndtbtNqWabN+.x Pp=Eб;`c "ǚM8N (*Y" NA5E/֒J)ƈ~Ta3ȮD/IHM8-dh)BM9b2(q2Z8b2 > !ZDQlˠ{zN1 /GH.C>Z4wcsjF5D3o#w/G>_}$qx#H+q=Ge!DS{CUJPV o JPV o~ѕ ^ ] jKb ۧ?6BtE.3GYRqb#?C6+ /*|~XWSJB9(#}]hXP`E)8d2 %G !="M?V-WZw.x!\B~la 1h29tmS ?,uД>)" /h}Lʴh:Ng;͌b\6{TI_miބB[SfH ? l٪XV˚N>{El'^d}.Ksd%'}@ !>:a7d_*Ҕ7R(`kooFhXTㅽ^b"B6]uux& lǸ)ztPvc;ZSO&~e_1yʺֽS1l9&Zvq~l<3#y"0wct2lK@󭕭 %rJ`x/%(ݤW &YH~%? $C|QqrLֳ}' Mˁ9ޟX7q犓rMZEϼ 3s7/i{!lakx ܂ܶ? V(; ~PX µ>sŻzEѬQ!ښ1:xUR c [ϸ62#񔭈L ɡc[luUFsѵ^&V0NwF'Qwu!\lחA'GR)l< ܛFߒ$ۙr \P%KXi !Sc׍K⼭mDJ͋DͲ6p’i#ӦVMVR5Jn7J4zvr6U+筕R 'ۉZETmZhI5$ۖbSGSt_}LF銂i(X)Rq +R-"0ǠbQQnԧlW׮e/fT"l,~xb}Jq2ff#TR6VԘ !R@*e1W9$pa'yLp&Wr[Wr15x}ovVm#>` xfUsegUӱ5=$꒗-ުN3ի5t.?WN+ Š!ЂV/1?Imh򕺿w"JVuK>mWw\'֩^B~»ZM|xS7}=j&!﫻Ctwh+]Ok%}OU͞-SyNLZqY%UX+ktR@?!+۷cSJUV\ d+Siٽ+z㍣@ElF 82hTíltStw>3--B1 ~Q a#IYh\/xڇ 5@^H ' QS1f=. D0h0 |͈j0 TH7;ƣaxUe+<;V5Izs8IP0ק*],mCTd: i ʤTNu:)% ڇAWu*\p@DMRl$ݟ h | mMϋ$Pg0i" jUdDDCIFvH9Lm#JRaI+HX}T"AW*RRi$N*VR+-W^Ujno%ZŪ!bYJ쵯&!8&Oc,D$W%K+QJ2C&ôJRaI:)E JD"W*\N*Vrn0 zu3zbOO~#=ڢRl%B IBs6SӧQOȥKfi=s3*u=o& *3"9Kecw=FsAd!Swj_4éwoCpQ.e"nf $Bq0[|5Eg' }^ ' ,ޛ6b*#e ^~l 'ms-cEY4ƗAg8> Q% ֧R|"Nڭ ?64)~KYIIɇzyD>n>ݳϊW;luxIZsTH҉Ո`p,%۸C.|aLǴbK<,g+|?wټ\~4%<{!2[C-ې@:}OUiЃjx 7_xR{K37yD%!ut GU A{~do:]SAQ U(C )Z{Yםm!_V爘u߈9}of#W3wz?nvsMlW[.b7!'Vd`//wN eL=j"2g61jXF'"zo/'eK//cC8.$ow xsX^+5_\܋Iس 0*ڣZn ୡBW` QMW=xRkr.,aELNA޽"uh96xX Le>u˻t`n\ 7q: oAUB~% D5_m9&KtYiFpx׺ +-3^X#L^i,Z x TQ[3]8k'?1ƽ5f~rL(=mx?B6 6,{mnsm?)w<ܚSDxPR7+V߭_uY!AEna=O+S8'ar_3'cs٠46pV_zGu0 >P3 ]h JmMt~xA-(@*М}7r}R犙q:i-y>/"[Svs/0"51!T \ʓ:I"`q1K1 7a:F'%kHҭc_xˆ\LYؤb> endobj 54 0 obj << /Type /Font /Subtype /Type1 /Name /F6 /BaseFont /NewCenturySchlbk-Bold /Encoding /WinAnsiEncoding /FirstChar 32 /LastChar 255 /FontDescriptor 64 0 R /Widths [ 278 296 333 574 574 833 852 241 389 389 500 606 278 333 278 278 574 574 574 574 574 574 574 574 574 574 278 278 606 606 606 500 747 759 778 778 833 759 722 833 870 444 648 815 722 981 833 833 759 833 815 667 722 833 759 981 722 722 667 389 606 389 606 500 333 611 648 556 667 574 389 611 685 370 352 667 352 963 685 611 667 648 519 500 426 685 611 889 611 611 537 389 606 389 606 606 606 606 241 574 481 1000 500 500 606 1000 667 333 1000 606 606 606 606 241 241 481 481 606 500 1000 606 1000 500 333 907 606 606 722 278 296 574 574 574 574 606 500 333 747 367 500 606 333 747 333 400 606 344 344 333 685 747 278 333 344 367 500 861 861 861 500 759 759 759 759 759 759 981 778 759 759 759 759 444 444 444 444 833 833 833 833 833 833 833 606 833 833 833 833 833 722 759 611 611 611 611 611 611 611 870 556 574 574 574 574 370 370 370 370 611 685 611 611 611 611 611 606 611 685 685 685 685 611 667 611 ] >> endobj 55 0 obj << /Type /Font /Subtype /TrueType /Name /F7 /BaseFont /NewCenturySchlbk /Encoding /WinAnsiEncoding /FirstChar 30 /LastChar 255 /FontDescriptor 66 0 R /Widths [ 750 750 278 278 355 556 556 889 667 191 333 333 389 584 278 333 278 278 556 556 556 556 556 556 556 556 556 556 278 278 584 584 584 556 1015 667 667 722 722 667 611 778 722 278 500 667 556 833 722 778 667 778 722 667 611 722 667 944 667 667 611 278 278 278 469 556 333 556 556 500 556 556 278 556 556 222 222 500 222 833 556 556 556 556 333 500 278 556 500 722 500 500 500 334 260 334 584 750 556 750 222 556 333 1000 556 556 333 1000 667 333 1000 750 611 750 750 222 222 333 333 350 556 1000 333 1000 500 333 944 750 500 667 278 333 556 556 556 556 260 556 333 737 370 556 584 333 737 552 400 549 333 333 333 576 537 278 333 333 365 556 834 834 834 611 667 667 667 667 667 667 1000 722 667 667 667 667 278 278 278 278 722 722 778 778 778 778 778 584 778 722 722 722 722 667 667 611 556 556 556 556 556 556 889 500 556 556 556 556 278 278 278 278 556 556 556 556 556 556 556 549 611 556 556 556 556 500 556 500 ] >> endobj 56 0 obj << /FontFile2 57 0 R /Type /FontDescriptor /Ascent 811 /CapHeight 689 /Descent 189 /Flags 34 /FontBBox [ -101 -251 1000 1000 ] /FontName /Arial012 /ItalicAngle 0 /StemV 0 >> endobj 57 0 obj << /Length 273020 /Length1 273020 >> stream pDSIGGDEFQQ7&GSUB'JSTFm*i*\LTSH!UdOS/2 2kVPCLT{>C6VDMXPjZxcmapܣ.@cvt pv|0fpgmw'w gasp Pglyfq hdmxB:(yheadGN|6hheam$hmtxWnd:kern7a96D`locaA Dmaxp  name6`+postƬ%E01prepql {_<'*Kg:L >NC3: ?c/B 33f zMono@ Q3>@FN ^ t~&h   b f< \V16/=l q}b E a> 1 3 Z.]       ^  G Q i w &; a  b f   u \')  ' '  ' ''' '' '(( ( (+$(7*(E-(S  (a (m  (y  (Typeface The Monotype Corporation plc. Data The Monotype Corporation plc/Type Solutions Inc. 1990-1992. All Rights ReservedArialRegularMonotype:Arial Regular:Version 2.76 (Microsoft)ArialVersion 2.76ArialMTArial Trademark of The Monotype Corporation plc registered in the US Pat & TM Off. and elsewhere.Monotype TypographyMonotype Type Drawing Office - Robin Nicholas, Patricia Saunders 1982Contemporary sans serif design, Arial contains more humanist characteristics than many of its predecessors and as such is more in tune with the mood of the last decades of the twentieth century. The overall treatment of curves is softer and fuller than in most industrial style sans serif faces. Terminal strokes are cut on the diagonal which helps to give the face a less mechanical appearance. Arial is an extremely versatile family of typefaces which can be used with equal success for text setting in reports, presentations, magazines etc, and for display use in newspapers, advertising and promotions.http://www.monotype.com/html/mtname/ms_arial.htmlhttp://www.monotype.com/html/mtname/ms_welcome.htmlNOTIFICATION OF LICENSE AGREEMENT This typeface is the property of Monotype Typography and its use by you is covered under the terms of a license agreement. You have obtained this typeface software either directly from Monotype or together with software distributed by one of Monotypes licensees. This software is a valuable asset of Monotype. Unless you have entered into a specific license agreement granting you additional rights, your use of this software is limited to your workstation for your own publishing use. You may not copy or distribute this software. If you have any question concerning your rights you should review the license agreement you received with the software or contact Monotype for a copy of the license agreement. Monotype can be contacted at: USA - (847) 718-0400 UK - 01144 01737 765959 http://www.monotype.comhttp://www.monotype.com/html/type/license.htmlTypeface The Monotype Corporation plc. Data The Monotype Corporation plc/Type Solutions Inc. 1990-1992. All Rights ReservedArialRegularMonotype:Arial Regular:Version 2.76 (Microsoft)ArialVersion 2.76ArialMTArial Trademark of The Monotype Corporation plc registered in the US Pat & TM Off. and elsewhere.Monotype TypographyMonotype Type Drawing Office - Robin Nicholas, Patricia Saunders 1982Contemporary sans serif design, Arial contains more humanist characteristics than many of its predecessors and as such is more in tune with the mood of the last decades of the twentieth century. The overall treatment of curves is softer and fuller than in most industrial style sans serif faces. Terminal strokes are cut on the diagonal which helps to give the face a less mechanical appearance. Arial is an extremely versatile family of typefaces which can be used with equal success for text setting in reports, presentations, magazines etc, and for display use in newspapers, advertising and promotions.http://www.monotype.com/html/mtname/ms_arial.htmlhttp://www.monotype.com/html/mtname/ms_welcome.htmlNOTIFICATION OF LICENSE AGREEMENT This typeface is the property of Monotype Typography and its use by you is covered under the terms of a license agreement. You have obtained this typeface software either directly from Monotype or together with software distributed by one of Monotypes licensees. This software is a valuable asset of Monotype. Unless you have entered into a specific license agreement granting you additional rights, your use of this software is limited to your workstation for your own publishing use. You may not copy or distribute this software. If you have any question concerning your rights you should review the license agreement you received with the software or contact Monotype for a copy of the license agreement. Monotype can be contacted at: USA - (847) 718-0400 UK - 01144 01737 765959 http://www.monotype.comhttp://www.monotype.com/html/type/license.htmlNormaloby ejnnormalStandardTypeface The Monotype Corporation plc. Data The Monotype Corporation plc/Type Solutions Inc. 1990-1992. All Rights ReservedArialRegularMonotype:Arial Regular:Version 2.76 (Microsoft)ArialVersion 2.76ArialMTArial Trademark of The Monotype Corporation plc registered in the US Pat & TM Off. and elsewhere.Monotype TypographyMonotype Type Drawing Office - Robin Nicholas, Patricia Saunders 1982Contemporary sans serif design, Arial contains more humanist characteristics than many of its predecessors and as such is more in tune with the mood of the last decades of the twentieth century. The overall treatment of curves is softer and fuller than in most industrial style sans serif faces. Terminal strokes are cut on the diagonal which helps to give the face a less mechanical appearance. Arial is an extremely versatile family of typefaces which can be used with equal success for text setting in reports, presentations, magazines etc, and for display use in newspapers, advertising and promotions.http://www.monotype.com/html/mtname/ms_arial.htmlhttp://www.monotype.com/html/mtname/ms_welcome.htmlNOTIFICATION OF LICENSE AGREEMENT This typeface is the property of Monotype Typography and its use by you is covered under the terms of a license agreement. You have obtained this typeface software either directly from Monotype or together with software distributed by one of Monotypes licensees. This software is a valuable asset of Monotype. Unless you have entered into a specific license agreement granting you additional rights, your use of this software is limited to your workstation for your own publishing use. You may not copy or distribute this software. If you have any question concerning your rights you should review the license agreement you received with the software or contact Monotype for a copy of the license agreement. Monotype can be contacted at: USA - (847) 718-0400 UK - 01144 01737 765959 http://www.monotype.comhttp://www.monotype.com/html/type/license.htmlNormalNormaaliNormalNormlNormaleStandaardNormalNormalnyNormal1KG=K9NormlneNormalNormalNavadnothngArruntaNormalNormalNormalNormal &&~ #~ O\_ :Rkmq~    " & . 0 3 : < > D o  !!!!"!&!.!T!^!!"""""""")"+"H"a"e###!%%% %%%%%$%,%4%<%l%%%%%%%%%%%%%%%&<&@&B&`&c&f&k:1 6<>ADOY}b?  #~Q^ !@`mq~   & * 0 2 9 < > D j  !!!!"!&!.!S![!!"""""""")"+"H"`"d### %%% %%%%%$%,%4%<%P%%%%%%%%%%%%%%%&:&@&B&`&c&e&j: *8>@CFVz^>/wkri+*)(i3][w}ujy,ߨߖޖޢދަq_0@3$FE<9630)"ۿ۾۷ۥۯEBA$"!9>c$FxFJXZV^^HHJF ^bcdefghjikmlnoqprsutvwxzy{}|~      !"#$%&'()*+,  -   ./0 !"12#3$%&'()*+   4NORPQUVWXST~?Avw|qrsYZ[\]uwvyx}  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&&~ #~ O\_ :Rkmq~    " & . 0 3 : < > D o  !!!!"!&!.!T!^!!"""""""")"+"H"a"e###!%%% %%%%%$%,%4%<%l%%%%%%%%%%%%%%%&<&@&B&`&c&f&k:1 6<>ADOY}b?  #~Q^ !@`mq~   & * 0 2 9 < > D j  !!!!"!&!.!S![!!"""""""")"+"H"`"d### %%% %%%%%$%,%4%<%P%%%%%%%%%%%%%%%&:&@&B&`&c&e&j: *8>@CFVz^>/wkri+*)(i3][w}ujy,ߨߖޖޢދަq_0@3$FE<9630)"ۿ۾۷ۥۯEBA$"!9>c$FxFJXZV^^HHJF ^bcdefghjikmlnoqprsutvwxzy{}|~      !"#$%&'()*+,  -   ./0 !"12#3$%&'()*+   4NORPQUVWXST~?Avw|qrsYZ[\]uwvyx}llll<j T  x X JfP ZxXN@@ !"#6#%%&B&((*+,-B.02.23^46x9&:;< ?@B"CVDEG GHI~KL$MRNfO~PQRTUVX`[^]_`abcccd"d^dde(edeef fZffggTggh hPhhhi,ibiijjXjjjk0klFn8oq|qr\tDvxytyz`{~|j~VF`>bX&4 \NNxRj<ZffFx8.jH6fX&ZNF8l~t@6Þ8rĶ8hŘ>xǨ 8jɨʴ"f˖ ̶lͰ.lΠ Bπϼ4pафҜ"VԐF|վdtܮݨ<d `<(6"BbJr&P|>h*nHz bHdB ((hpvxp4>.^"RBrT   0 `      DtD.@xB^,\&V4d4d* !#0%`')<)***:*,r-P.../133344555&565F66(6866707@8*8:8J8Z9f::; ;@;p;;< =R>(? @@A@BZC2CBCRDDEFGHIKKFK~KKL L0MMLNpNNNNOPQQR*RRSSTTTWXlXY"Z@ZZZ[[[[[\]]^B^_`Vaabbccde&fRfgXghizjkkm mooopRpbprpprrrs stpu^vvwwy zzT{{|||}}~~H:x2 NvBv>~h(^ <`pB p2~HL4d(.f(2 \<H*hz$bzB jt< Hæ(ƆưǒǼBl˖@j͔;<fΐBм(R|ҦP\׊ך&l8>޾^0Z,V(R| &PPV @Bz(R|$Nx JtFpBl^t~ J   B Vn~>NdJZn~H  !"l"#$2%&z&'"'2'((()*++-<-L//113:3J4:4J5577 8`8p88:::(:8;<=>@ ABCDDEFHXHhIJLLLLMNNNOOPPRRRRRSU>VjWdWtWWY2Z[[^0`zcehgjbl2mnn@nPn`nnnnno(oRoboroooppp p0p@pPpzppppqqBqlqqqrr>rhrrrss:sdssst t6t`tttuu2u\uuuvv.vXvvvww*wTw~wwwx&xPxzxxxy"yLyvzzZzz{${N{x{{{| |J|t|||}}F}p}}}~~B~l~~~(\xzJ.t(Fn(^`Tjbr**<(:L^p06 `.xHRdrf,`B PZ&L~f"v&N4f@n(^0`>j8p2bP<pj8X % >u&5#'eS79]9q7$5S+7Ƥc  ) R M_c  S>+. . -%&%&.. ' '9%.7.7$..+.7.7cc0 -&&22222+11%&. . ' ' 'SS.7.7>>>>9]9.7$$.+.7.7.7.79%& ) %% .>u..M'> &)))$1$$$)(*)$)* % >>17 1%$%  u..11M+%11.&1$&'( 77 77$75 11,1$*1%'7&1+9$$7 71    ,    , , ,, # #+ ,,,,,,,,,))))++++22222222##22,,,,#### +9%&%&%&%&%&%&%&%&%&%&%&%& ' ' ' ' ' ' ' '>>9$$$$$$$77ĖĖ%&>9$77777    !" # $!%"&"'#($)&*&+',(-(.*/+0-1-2.3/405061738494:5;5<6=7>8?9@:A;B<C<D=E>F?G@HAIBJBKCLDMFNFOGPHQIRISJTKUMVMWNXOYPZP[Q\S]T^T_U`VaWbWcYdZe[f\g\h]i^j`k`lambncocpdqergsgthuivjwjxkymzn{n|o}p~qqstuvvwxyz{|}}~   !" # $!%"&"'#($)&*&+',(-(.*/+0-1-2.3/405061738494:5;5<6=7>8?9@:A;B<C<D=E>F?G@HAIBJBKCLDMFNFOGPHQIRISJTKUMVMWNXOYPZP[Q\S]T^T_U`VaWbWcYdZe[f\g\h]i^j`k`lambncocpdqergsgthuivjwjxkymzn{n|o}p~qrstuvvwxyz{|}}~   !" # $!%"&"'#($)&*&+',(-(.*/+0-1-2.3/405061738494:5;5<6=7>8?9@:A;B<C<D=E>F?G@HAIBJBKCLDMFNFOGPHQIRISJTKUMVMWNXOYPZP[Q\S]T^T_U`VaWbWcYdZe[f\g\h]i^j`k`lambncocpdqergsgthuivjwjxkymzn{n|o}p~qrstuvvwxyz{|}}~A#/O__o@3@3@jl2@a3@\]2@WY2@MQ2@DI2@:3@142@.B2@',2@%2 2Ap@$&2d 2A d2AJ?/?_?Ӳ792Ӳ+/2Ӳ%2Ӳ2Ӳ2Ҳ) +A0 P`p`p   0@Pв +ϲ&BAƲA /$A/?O_"dA @j@&CI2@ CI2@&:=2@ :=2 &@&2@ 2@&2@ 2@&2@ 2@&z2@ z2@&lv2@ lv2@&dj2@ dj2@&Z_2@ Z_2@&OT2@ OT2$'7Ok Aw0w@wPwwww**@+)*Re~<^+@8@@89@s&%$ 7@!I3@!E3@!AB2@!=>2A!?!!!!!@! "2@!2@"*?2@!.:2oAH/`?_"""/"?"_"""!!o!!!/!?!O!""!!@+HO7 A &A9&%8s542V&, /& 8ʸ&~&}Gke&^s@R&ZHDb@s?^<&50+*V)#U7h@,XO62,!  @+JKKSBKcKb S# QZ#BKKTB8+KR7+KP[XY8+TXCX(YYv??>9FD>9FD>9FD>9FD>9F`D>9F`D+++++++++++++++++++++++KSXY2KSXYKS \XEDEDYX>ERX>DYYKVS \X ED&EDYX ERX DYYKS \X%ED$EDYX %ERX% DYYKS \Xs$ED$$EDYX sERXs DYYKS \X%ED%%EDYXERXDYYK>S \XEDEDYXERXDYYKVS \XED/EDYXERXDYYKS \XEDEDYX ERX DYY+++++++++++++++++++++++++++++++++++++++++eB++;Yc\Ee#E`#Ee`#E`vhb cYEe#E &`bch &aeY#eDc#D ;\Ee#E &`bch &ae\#eD;#D\ETX\@eD;@;E#aDYGP47Ee#E`#Ee`#E`vhb 4PEe#E &`bch &aeP#eD4#D G7Ee#E &`bch &ae7#eDG#D7ETX7@eDG@GE#aDYKSBKPXBYC\XBY CX`!YBp>CX;!~ +Y #B #BCX-A-A +Y#B#BCX~;! +Y#B#B+tusuEiDEiDEiDsssstustu++++tu+++++sssssssssssssssssssssssss+++E@aDstK*SK?QZXE@`DYK:SK?QZX E`DYK.SK:QZXE@`DYK.SK=<;:987543210/.-,+*)('&%$#"!  ,E#F` &`&#HH-,E#F#a &a&#HH-,E#F` a F`&#HH-,E#F#a ` &a a&#HH-,E#F`@a f`&#HH-,E#F#a@` &a@a&#HH-, <<-, E# D# ZQX# D#Y QX# MD#Y QX# D#Y!!-, EhD ` EFvhE`D-, C#Ce -, C#C -,#p>#pE: -,E#DE#D-, E%EadPQXED!!Y-,Cc#b#B+-, EC`D-,CCe -, i@a ,b`+ d#da\XaY-,E+#Dz-,E+#D-,CXE+#DzEi #D QX+#Dz!zYY-,-,%F`F@aH-,KS \XYXY-, %E#DE#DEe#E %`j #B#hj`a Ry!@E TX#!?#YaDRy@ E TX#!?#YaD-,C#C -,C#C -, C#C -, C#Ce -,C#Ce -,C#Ce -,KRXED!!Y-, %#I@` c RX#%8#%e8c8!!!!!Y-,KdQXEi C`:!!!Y-,%# `#-,%# a#-,%-, ` <<-, a <<-,++**-,CC -,>**-,5-,v##p #E PXaY:/-,!! d#d@b-,!QX d#d b@/+Y`-,!QX d#dUb/+Y`-, d#d@b`#!-,&&&&Eh:-,&&&&Ehe:-,KS#KQZX E`D!!Y-,KTX E`D!!Y-,KS#KQZX8!!Y-,KTX8!!Y-,CXY-,CXY-,KTC\ZX8!!Y-,C\X %% d#dadQX%% F`H F`HY !!!!Y-,C\X %% d#dadQX%% F`H F`HY !!!!Y-,KS#KQZX:+!!Y-,KS#KQZX;+!!Y-,KS#KQZC\ZX8!!Y-, KT&KTZ C\ZX8!!Y-,KRX%%I%%Ia TX! CUX%%88Y@TX CTX%8Y CTX%%88%8YYYY!!!!-,F#F`F# F`ab# #ŠpE` PXaFY`h:-&iiiD|ZRRD/W~ "APoLu\7LnpX cc-\ @Wr]g!wM+Le|C]h5G!\M-x ,I?)9Io#o 2@z1UW~~FB/OV)or,11di+ &  sC_a^m8Q[h|ATkhqBBSsX2Q|  !U{{~!""#rw"+5<Yoq22 *<Qaajx *>LQ_jqx !".5BOO^eq *G]ety "&+G_u\ m6>PQ]`E3-_dM?}$x;;N&;MKSj1<ex ~ 90+ P >X!q}E +NT2N7kwdg3|)n*i9$]u MRhm}qyXgV%|2!r\/AMrLjUxiWnTgeRZgn-|{pLFF-S%F>S?("bJmH3NFpyQ hlOa+999^ssIwVXZ||@r9A99sUss<sVssUsMsasSsU99prpsZoVVfV9m97Vs9cV9XV\0V V V)999'6sYsJsPsFsK9sBsssDssH?9$s!(9/WVVhV9csJsJsJsJsJsJPsKsKsKsK99#99 ssDsDsDsDsDsssssI3skssQmL=dN9SdNdMdMs8zd1/-%DrdTs.d3ssVV9cRsSGldN/!VV9s\\sI9lG%VVVVV99999c9c9c9.k:(sV\?)(sIV!Vsrk!kk!s9msB9V\?fPfPsFkVsJVsJGVsKVsKsBsUsss9csD<V\?09$0#ss)()(h9`bUHtHbD).0HkR3OOOjrq"~~~~~~f0 0 *+kUo@:@7?@%UapVsJfPfPVsKVsKVsK9msB9msB9msBss9999999f7Vsss9csD9csDkV\?09 ssssV!VsJD9S9V!sZk""JkWF2xVVXV)9VX 3m9cV0VV a9VHbsk`Hss\\sDV`3z?W`sH`?WW2UdV\997u 1 V@VUkVcN@9cVf0 RV UWUU@UsJ[@sKZ2xxksDUsP&!K+Ek(+0UsKsK?9 @s!kJA-11~~!}3 9iV21-_(P<P<Z<n_s f(d$(ZVZ((WWH-ddddiiiV21-KJK(P<P<Zn_s f(d$(V2P_s<%QCMyFFFFHFFQF5|5.555,5555555B6555F656==ZvZ'ZvZ'2j0FF@FQ sJ]My"VVuxux-Y2jYB=656==656==656==????Z*65'Z*65'OmOm$$ss''  ii''55B6='uxux2j2jZ@@Z&0ZSAZSAFFQFFHFFFFF@0FFc?D[/Ts) grksSrj}_vlX,VsJVsJVsJVsJVsJVsJVsJVsJVsJVsJVsJVsJVsKVsKVsKVsKVsKVsKVsKVsK9c9|9csD9csD9csD9csD9csD9csD9csDc?Dc?Dc?Dc?Dc?Dss[[[[[V!V!V!VsJ99csDsssss                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          "                                                                                                                                                                 "               &                                                                                                                                                                  &                     *                                                                                                                                                                    *                            0                                                                                                                                               0                                 6                                                                                           6:                                                                                          :    @                                        #    !"                  "      "                    ####          @   !B    " "          ! !  !!!                 $!!! !!!!!"#       "! """      #!!   !#              !   $$$$         !B   %J !   & &         % % ! %%#%    %           (%%%$%%%%%&'" !       &%! &&&      '% ""#!% "%(                ##%      ))))       %J               *T %   +! #!!*    $  ! **!#  %*!*(*  + !!!    ###!   ! !".***)*****+,'  %!!!   !! * *%! *** ####!#!#  #!#   ! !$ ,*$'#! ''!%*#"#  &"*-      %              "'"' *       ####..$$..$$!!         *T$$##  !!!!!!!$$$$$$$$$$ !.\# )    /!!$! %!$$!!.   & ! !!$! ""..$!!&#).$.+.  . $$$!!!    !&&&$ !!!!  !!$!! !!$%2...-!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"...../0*###" )!!$$$!!   !!$$! !!!!.! .)$ .!.!.! &&&&$'$&# ! %!$!&"   !$ $(! 1.'!*!!%!$!!#"*+$)!.! &%&!# *%.1        %       ## ###### ###########!! ####%+%+################ ##.#############################   !! !! !! &&&&33''33''$$     ## ### ## ### # ##############################################################################.\''&&  $$$$$$$'''''!!''''' $!!!!!2d&,! 3!!$$!'$!)$'!'$!$!2!!  (# !!$!$'$%%22'$$)&,2!!'2/2 ! 2!!!!!'''$$$ ! $!!***'!$$!!$$!! $$'$$! $$'( 62221$##############################################$2111135.&&!&% ,!$$!!!'''$$  ! $$''$!$$$$2#! !2,' 2#2#2#! ****!'*'*& !!!!$!!)$!'$!!!*%!  $' '!+$!53+ $!!!"!.$$!)$'$!$ &!%!./(,!$3$!")()$&  -)26#    #  * #####  &&&&&&&& &&&&&&&& &&&$$ &&&&)/)/ &&&&&&&&&&&&&&&& &&2&&&&&&&&&&&&&&&&&&&&&&&&&&&&&   $$ $$ $$ ))))77**77**''       && &&& && &&& & &&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&2d+!+!** !!!!!!!!!!!!!!!!!!!!  '''''''+!+!+!+!+!$$+!+!+!+!+!!!!! '$$$$$6l)0$   7$$''$!*'$-'*$*'$!'$6##!  -' $$'$'*'!((66*'',)0!! "6$$*636 #  5$$$$$***''' $!'#$ ---*$''$$'!'$$ ''*''$!!''!!*+!#;6665' ! !!&"&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&'!65555!!!791))# )(! 0!!$''$$$***''  $ ''**'$!''''6'# $60*!6'6'6'#  ----$*-*,) $$$$!'$$-'#*'$!!##-(#  '* *$/'$97-"'$#$%$2!''#-'*'$'!")#($13+0#'7' $%,+,"')  1,6:% !   &# * &&&&!  &#  )))))))) ))))))))")))'' )))),2,2" )))))))))))))))) ))6)))))))))))))))))))))))))))))!  " '' '' '' ,,,,;;..;;..++   " "     )) ))) )) ))) ) ))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))6l.#.$-- $$$$$$$$$$$$$$$$$$$$  *******.#.#.#.#.#''.$.$.$.$.$###$ *''''':t, 4' " """ ;''**'#-*' /*-'-*'$*':%&#     1  )"''*'*-*    #++: :-) !)0 -4##" $ :''-:7 : &   9'''''---*** '#* &' ""000 - '** ' ' *$*' '  * * - **'$$* * ## -." $& ?:::9*"#"##)$)))))))))))))))))))))))))))))))))))))))))))))*#:9999###;=5,,&",+# 3##' **' ' ' - - - * *   ' * * - - *'#* * * * :)& ' :4-#:):):)&  #0000'-1-0, ''''#*''/*&-*'$$&%0+&" ! ! ! )- -'2*'=;2"%*'&'''6#**"&/*-*'*$%,%+'56.3&*;* !" ' "(  0!/0$*,   5/  :>(!##"##!!  (%.((((!!!#"#!!  (% !  ,,,,,,,, ,,,,,,,,%,,,)),,,,!/6/6%",,,,,,,,,,,,,,,, ,, :,,,,,,,,,,,,,,,,,,,,,,,,,,,,,$  %" ))))))!!!0000@@11@@11""""""""  ..""## %"%" # # # #,, ,,, ,, ,,, , ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,:t2&2'00 ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' '   - - - - - - - 2&2&2&2&2&* * 2'2'2'2'2'&&&'  - * * * * * C2%%<- '%%%%%%%%%%'''%D--00-)40"-%704-40-)0-B+-)%%%"%%%%"9%%%%"%!/ !!'--0-040%%%%%%"%%%%%%%%%%%%%%%%%%$)11C%C40%%%%'!07%3<))'%%%)%%C--4C?%C%!!- %""%C-----444000%-")!0%-!-%''888%4%-"0"0"%%-%-%0)0-%-%%%%0%0%4%00-"))0%0%)!)!%45'%)+%"IC"C"C""B0'('((/*/////////////////////////////////////////////1(CBBBB(((DG=22$,(""21( ;((-%0"0"-%-%-%4%4%4%0%0%"-""%0%0%4%4%0-")0%0%0%0%B/-!-%C<4)B/B/B/-!%(8888-58482----)0--70,40-))-+82-'%%'"%%""'!%& %#04%%%4-:$0-"GD9'+0-,-$-->(00',7040-0)+3+2-=?5;,0D0%&$'%-%%'.%%$%"!7 C*0#"2$%%""=6%!%!CH.&$"((("((&#&% %"/+"""7""$////&&&$"(("(&&% %"/+$%'    ############222###2222222222222+222002222&#$$!!6>"6>"+'222222222222222222%C22222222222222222222222222222)+'000000&#$$&#$$&#$$!!!!77$$77$$JJ99JJ99''''''''$#$#55''((""##+'+'$($($($(22 222 222222 222222222222222222222222222222222222222222222222222222222222222222222222222222C9,9-"88-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%4%4%4%4%4%4%4%9,9,9,9,9,0%0%9-9-9-9-9--!-!-!-%4%0%0%0%0%0%K8**C2,**********,,,*L22662.:6&2*=6:2:62-62K11."***&****&?****&*%5$%%,22626:6******&******************(.77K)K:5)))*+%5>):C..,)*).**K22:KG*K)%%1 *&&*L22222:::666*2&.%6*1%2*,,???*:*2&6&6&*)2*2*6.62*2****6*6*:*662&--6*6*.%.%):<+*!.1)&RK&K&K&&I6,-,--5/5555555555555555555555555555555555555555555557-KJJJJ---MOE88(1-&&87!-B--2*6&6&2*2*2*:*:*:*6*6*&2&&*6*6*:*:*62&.6*6*6*6*K51%2*KC:.K5K5K51%*-????2;?:>82222.622=61:62.-11?81+!*)+&!**&&+%"*+$)'5;)*);2A)62&OL@,06212)32E-66,1=6:626-09172EF;B16L6*+(,*2"**!,4)*)*&"%>$+'<>/6'&8)**&&D=*!%)%KP4*)&--,&##--+(*)#$)&40%%%<&&##(4444***)&-,&##-+*)$)&40)#)+ ''''''''''''888'''88888888888880888668888*'((%%=F'=F'0,888888888888888888*K88888888888888888888888888888. 0,666666*'((*'((*'((%%%%>>((>>((RR??RR??,,,,,,,,)"')"';;,,--&&''" 0,0,)-)-)-)-88888 888888888888888888888888888888888888888888888888888888888888888888888888888888888888 K@1@2&??2*2*2*2*2*2*2*2*2*2*2*2*2*2*2*2*2*2*2*2*:*:*:*:*:*:*:*@1@1@1@1@16*6*@2@2@2@2@21%1%1%2*:*6*6*6*6*6*S>..J7 0..........000.T77<<73A<*7.E>,61**>=%2I227.<*<*7.7.7.A.A.A.<.<.*7+*.<.<.A.A.<7*3<.<.<.<.S;6'7.SJA3S;S;S;6'.2EEEE7AF @D>77773<77E<6A<73468E>60%.-0*%..**0)%./(-,;A-.-A7H-<7*XTG05<767-87M2<<06E-..**KC.$'.)"SY9 /-!*2 21*&&220,/-&(.*:5)))#C**&&,::::///-!*2"1*&&20/-(.*:5-&-0",,,,,,,,,,,,>>>,,,>>>>>>>>>>>>>5>>>;;>>>>/,,,))CM!+CM!+51>>>>>>>>>>>>>>>>>>.S>>>>>>>>>>>>>>>>>>>>>>>>>>>>>3"$$51;;;;;;/,,,/,,,/,,,))))DD,,DD,,[[FF[[FF00000000-%,!-%,!AA0022!!**!!,,%!$$5151-2-2-2-2>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> SG6G8+EE7.7.7.7.7.7.7.7.7.7.7.7.7.7.7.7.7.7.7.7.A.A.A.A.A.A.A.G6G6G6G6G6<.<.G8G8G8G8G86'6'6'7.A.<.<.<.<.<.\E!33R=$633333333336663]==BB=8HB.=3KBH=HB=9B=[>=8)333.3343/M3334.3-A---6==B=BHB333333.333333333333333%333 18DD\3\HB33335-BL3""GR886233933\==H\W3\3--=3..3]=====HHHBBB3=.8-B3=-=366MMM3H4=.B.B.33=3=3B9B=3=3333B3B3H3BB=.99#B3B38-8-3HI53)9$<3."d\.\.\..ZB68688A:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAC8\[[[[888^aTEE1<7/.ED)8!Q8!!8!=3B.B.=3=3=3H4H4H3B3B3.=/.3B3C3H3H3B=.8B3B3B3B3[A=-=3\RH8[A[A[A=-37MMMM=HM#GME====8B==KBME=5)325.)33..5-)34,20BH232H=P2B=.a]O6:B=<=2>=U8BB6D=TVIQ*33(6?3323.*-L-50JL:B0/E233"/.SK3(-3-&\c?#42%/7#76/*+77 5142*,3/@;...&L//++1@@@@4442%/7&6/*+7 542,3/@;2*25!&000000000000EEE000EEEEEEEEEEEEE;EEEBBEEEE4011--KV$/KV$/;6EEEEEEEEEEEEEEEEEE3\EEEEEEEEEEEEEEEEEEEEEEEEEEEEE9&((;6BB#BBBB401140114011----LL11LL11eeNNeeNN666666662)0$2)0$II6677$$//$$00#)$((;6;627272727EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE \O/MM=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3H3H3H3H3H3H3H3OO>O>O>O>=-=-=-=3H3B3B3B3B3B3dK$88YC!!':!8888888888:::8fCCHHC=NH2C8SHNCNHC>HCcBB=+8!88288782T8887!281G111!!:CCHCHNH8888882888888888888888(888#6=JJd!!7dNG7778:1GR7%%MY==:787=88dCCNd^8d!!711B8!!228!dCCCCCNNNHHH!!!!!!!!!8C2=1H8B1C8::!!!SSS8N7C2H2H287!C8C8H=HC8C8888!H8H8N8H!H!C2>>&H8H8=1=17NP:8->(A72$md2d2d22bH:<:<>BBTKB:-87:2,8822:1-89074GN787NCV6HC2jeU:@HCBC6DC\@LBJC\^OYBHeH895$:8C.88,:E78682.1R194PR?H43K688$32[Q8,171)dkE!!!!!!!!!!!!!&!!!86(3<&<;3..<<#9597.073E@111*O33..6EEEE8886(3<);3..<#997073E@6.7: $)55555555555 5KKK555KKKKKKKKKKKKK@KKKGGKKKK855511Q]'3Q]'3@;KKKKKKKKKKKKKKKKKK8dKKKKKKKKKKKKKKKKKKKKKKKKKKKK K>)++@;GG&GGGG855585558555""""1111RR55RR55nnUUnnUU::::::::6-5'6-5'OO::<<''33""''55&-'++@;@;6<6<6<6>  %@9Ou!  %9  h+]+]+<<<<<<?<<r 88)^  1^ j7q+]]]]]]??.+}<<<10]]]]]]]]]]]]]]]]]]]]]]]]]]%#"'&5467&&5463267&6654&#"326YzkcBϝ-0ReymuE_GIa##MfQcc|SrBøєXt(|[FEh?K_^D"K*5WIYeZ'&@ jq+]?991053.0|Q`=@ '33@^ +]?|G_<@6;;I Y Tk dzz  @  O @ s@!#4 8@ ?_o$+]+<?<c`Ҋ~K|]Ya p@    @0 s@!#4O_os O__?_o+N]q54'#"5432#"&4&#"326p|aS}P66mƏ{z˥tx|}SznLp Vk4Ĝ&8@  << 54&#"'6632531$8wsZX6i$jM:;+b:i`tNJ`loQGW@W! !!%5 3EID!F$FIGVTz)%)& *&)569C%VY[!V)VIYVee%f)vzr$!&PS@ '0 P  HCKC: : +p++M'/H$@P>$$0p?8*$+ #@ 55XW+N]M]]/]???]99910]]%#"&&5463273327654$#"3 $73#"$$'&547!2#"&'&32>54&#"AQYirW9")5Vr}bX3CTdz@ra̶EU T8|qHa@qj@K[h؁?[]a'=P "g~ir啽 ɭ*'LCfAY@c/0gh ` YVPh               p@  @  @ eRP@ P    @+]q]q]q?<?<<.+}ć.+}9999ć10K SKQZX8888Yrq]#3#!!&'3XݫF"3FDZw*@PF#V#f#s iup s  ' '* **))&T%& ,  ]+;\+]<54&&#!&sfgW=8JKFm^&CZ:TYe^3'g`1RfMIo) 8kFRy1fv@`cj 2 cpt  *(* G VWVhk{޲(9@'(9  &J& & c\+N]MN]M??910++]]q]r#"$54$32&&#"326=כC,;3“\m憣1nU-銼Z@& C&    ];\+]<<]?<?rs^sg0pMQOa7" h @'4    ]    @4]  P ` p ;Y+]q+]<<]<<?(7@ * *) **9 67:*I*] ]*j i*`0 ) ((((D+,*499,IH,VY+fi+v +74/$42!_)o))/?@E' 2 )aa%!$[@'@&& &0&&&19@#409999%"/$?18]q]q+]<???9/]qq999910]q]q%#"&546676767654'&#"'>32#&326765@G CCSS``    jiju p  "_o@I0@P`p    $"$ +I$?14+]q]rKS#KQZX8Yrr??9/9/]]10]q]q#"4632&&#"326<r鉭Zj kl‚F@  % 4 D 55WT RSgde c`+<<Kp.$ .:5 KE FIW V g     3%%@`t$?O4P+N]qM]q<<??@dU]] U eko e '1:1AMAQ\Ramaxx P`p @  @ @ '*4  %&4@#403$@$*4?O47+N]+MNq++q+M??9/]*@` , %L E , &,#9 6J FVX h .#,'>#>'L',,6!6)?,F F!E)T!T)ic!c)`,,'!#'(@ 0`p}@A E" 3%3 %@`t%"$?O+,t!4P++N]qM]q<<??]??<10]q]q32676'#"5463253#"&32654&#"f 2Ct}vnэze۠Ꙧ}|zxXQ%2dZ7<ݘjx*@ 4%5E @$4  % @364   N@464p%@364 NGP+]q+<<]q+]q+?#ƹ @A 4%    #  # # %%%%%]%]@3#%?O$%x!GP++N]qrpXdL:&N_bX'l_:xxP>@@1 4y   $ @364   N@464p3%@364 N]q+<<<]q+]q+<<? @]  GHVYgi4::5EKKE\\ R]]Rmm dmmdw  [TT [ lee l  $@$%40 1@#40$@$%4?147+]+q+]]]+??10q]qC\X@ SS bb ]Y7632#"32654&#"D{'v i!>@ -=K?  ) #22Bp ::JJY[ \\jk imk  #++5:FJZ   $  @ `  t33%?OG7+N]qr@ +*;Ky ??K44?DDSScc` )" +95 IF Zi    3%@`t$?Ot!4P++N]qM]q<<????9910]]qq#"466325332654&#",*Uo~q!xsvui;N.C>@;/#4CSft      (" "%@364 NG+]q+<]r???999999ɇ}10]r]336632&#">i?[^>BB;^&qH:'G?`r?>0@{"": J D$V"e"| $, 0K,U2 \\ \ \ \ \ jj j j j j &''&$'$)6$Z Y d&d(t#t$$ (,0 '(&&@9Z'%  & .@?O_oU@@4@4.\l. $@4[$*9**2@&'*4`22?222$ $"?O147+N]qMrN]q+q+M+r??q9/++]qr]qr99910Cy@@'-#,&"  (- !#"# ) (' +++<<+<<+++++*++]q]rq]732654'&'.54676632&&#"#"&?{|x5%ƙOA8*S}Z si|j/Vi}=kreD=#%2INGy(+H{gR\R7# $3A|\ZW$* #&4 @A#&4  +  "" % E E`p j6f+]q<<<??<<993310]++%#"&&5#5373#32LeclM,&@ 4 4@)4+$    3%@364N@464p % @364   NGP+]q+]q+]q+<???<99910Cy@    ++**]+++!5#"&&'&53326653?|^O nQQ;HmO5s1GQS9& ^5"9 @ 9 4444 @ !4(!4 @ "%4"%4 @(.4 (.4 )( & 95 HG VVYX ffii xwwyx w   ,   (& 7 O@ @4@ 4 %  %  /  "@@@  @@ @" +]]]9999?<<!4@J!4)( /99 IFFI O\TTZ Plccj {t{  &)+ 94,9 @'9:  % a+ a + [@," @`t ~Oot!|++N]q!4++++qY]C\X޲9 ޲9 9 = 9 @ 999++++++++Y35#!5!63!(sXOdoyjw^{ 9Q|*{@MG(44 4% 4')** %  %   %:%&:*':&**_i+ph+]<<<<<??9/9910++++q>7>7633#"33#"'.&&'9Ma  1H8&V8hD W]ncA_8b,@T aMdON5Tf= KEkt-.%D6ghPQY2~@v +N]!@@4 dH+!)d+++55Y&$?@ h+)++q55f[v&&"@0 0O0/0000H+)++]q5,&(Tj(@/H+!)++]]q5&1Q7@oO_zH+!)d++]]qqq5c&2@  dH+#!)++]55"&8"@_@4nH+!)+++q55J&D@/;?;;H+;")++q5J&DC@999 H+9")++]5J&D6@&: :0:p::::::::@.24:=A>")+++]qr5J&D @p<<<<bH+?")++]55J&D*@I@4I@ 4IIIдH+G")++]++5J&D@AAAh+A")++q55Po>&F-@/0 H+)++]]qr5K&H@!!! H+!")++]5K&HC&@ 4p H+")++]q+5K&H'@ @;5 @-24  # A$")++r++5K&H@"" dH+%")++]55.&+4@"%4/ZH+")++]++5#&C(@@4@"%4 H+")++]++5h&@  A ")++5 :&@ H+ ")++55&Q$("$4O((H+&")++]+5D'&R@H+")++]5D'&RC&@ 4pH+")++]q+5D'&R @@.24A ")++r+5D'&R@ nH+!")++55D'&R0@/+?+++O++/+?++H+)")++]]]q5&X!@@4O p+]<<<<<<<<?<<<:+N]M<]]{?{@{AsIsJ->?@AHIJ)) )$)"1HC EB?9% ":/'<HCB?:9/'% 6'@-' <>+^2><)O++L"^><8E)OKq+N]MN]M??999910]]732654'&%.5467&&54632&&#"#"&6654'&'&'zifs$>uJxiG:ȥiY\q$87GCI*pPOdm3JI45CQE..FihF3+K[gL`DsAz`c<4,D`-54&#"YЂ$\d-@͠~/2d7Ll ['(g m[kpr3l?  AY6MiƇjH]HhF8(>r99<'PX">_!6@@6,-&')-)0+1 +++ e01/d/t//г&-4/b@.,..,-,+*).012601(3-,+*/))5b77 !@?b@!""".//6O  o   b b;b&T/b.@756!6b J bBb Az+NMNM<<<<??]q<<<]<<9/9/999.++q}910Cy@J<>%$%=&%&%&& %&%>#;,!! !!<%?, !! !!++++++++++++++++++++]q]2#"$54$"32$54$!2#'&'&##32654&&##jjӪ,,Li+1GcHU4$EMrS(G`hk}Ѥէ+/,-p?Y0q&D8$9:3@  036p !$/0..`+8b@O$$o$$$$2b@ ++++b b/b. b!5b'd b<b ;z+NMNM??]]q]10Cy@T37%*)&%&%&& %&%3*57%5!! !!4(26&8 !! !!+++++++++++++++++++++]2#"$54$"32$54$#"&546632&&#"326jjӪ,,T{Ëdw wuOspZhk}Ѥէ+/$}ʄcmJOh@] 95JF  i b@  b;;b b@ 0`ٹ.+]<<<<?<<<<<<999910]]!5!!!33##e|{yyJ/uTJOeȳ44@&4oooOP`S٧+NM?]<10]]]]+++3ޅ=nH@#<<<_o$p+N]M<<<<?<991053353=N@         ?  %  0   %   U >q+<<<<<<9/9/?TX8'l@Owvx % &D dsy%{&%& Uk:%E/)6#  =) &i(h+??9910]]]]]'6632#"&5476%.#"3276F^L{/-ڎ(`A>v}fDKUur@"#l vy+<<?<IlUk{`0H8 F0#A<"Yw=>w=2(,&):N9- C/| |@)ip) ih+]]??10]2#"&546"32654&uQceOPdeȰįȅr~uuzt*@%99EJJF%YVif|zt%&;. H@) +;::+';'''':*:)((::'(/Ox@& Jj, (@((x@)$&J`)) ))++]q]]<]<<?<<<<]q]q?10Cy@ # "%& %&!$ #  ++++++++q]%&'&54$3 %!567>54&#"!5l9W^/PlW5`lP,Hd3cɏiC?`I]:?(&=gxHD>5<J@`=9=HL)O9Z)^9z(@0"4%LCB%DH[VVS%iged#wt&====F6....2: :'' F 2}@ 6%3=%.7@..?...@+5$3+0+@+++@ %"C$  ? O  K47+N]qM]M]q?<]?<9/]9/]10]]#"&'#"&5466767654&#"'>326632!3267!&&#"326762Mh{c–fiWx9iăf;(@sbCXgHz~Om,;jesE`ff`VN~e*MUuN2@FI}*Wvk"'"/LGarU4dg!+J@", %FTd(!"FI LLEK&Zfdf""+,+/"; =8&T-X \^&" !"!!|y!y"#j!i#z zlfm&u;"EJ&-,"9M CIF'z"v#"d mmh"""# @1!}!#"(-(,  % [[@% ($-4-@# 4---- ----$,3+N]qMN]q++]M??999999999.+}<<<<<<<<10C\X޲ 9!޶9""9#@ 9"%9@9++++++Y]]]]qq]]]]]]]]]]]]qqC\X@)"#"#$ ""-]q]qY]qq]7#"''7&'&532&#"32654'&c`k?zi^l;(&R[d4?Nb FVFdԍqPGDDm- *Fʖe?L9*SO&"@7|k|`k]]KRLK:D ')"@!<^l $$<"^"^ v#+]<]?<71$7wrYY6&"nM:;+b:jatOJ`ll& O@#< :8 8:<<  !++]<?/10KSX <F&7igq3x2*-@c$ #+$""%+-// "%!"%&!!5656EFEFVVeevv )-  )-$ #' p    : + p  '>$ >$##> > i/+>>>>i.+<<<<<<?]]10]]]]56323267#"&&#"56323267#"&&#"3j<{EE#A6@R .5@m&W DD#K&K*D-K2D4WWS#_&_*S-gh`$l&l*c-\2T4R[23#;&:*3->224 (% 53/+ 3 %}@ /@(@@3?ĵ0@ 4@!$?O647+N]qM+q]q?<]?<9/]99999910]]]]]%#"46326632!3267#"&32654&#"!&&#"Lzu3@|c +볆G\WM-K vxcd sX]nӦooiĺa~bo[@5 z+N]/M105!sʑ[@ 5 z+<]</105!ʑSZ @\~~llZZ      < < P@/o8< <@4u8<<q+N] @4 u<8' jq+]<<+<<?<?<9910qqqqqqqqqqrq]53'667353'667W+[,65+[,65ѥ;Q)G_Sѥ;Q)G_SQ ~@6{ Zl  <8oP@8'<  y+N]º(z-Q0X[RM`Eb:xLl*1FXQe\H,L9@ 9@uu< 0jKZ+]/10]++#3# ;9\H!4@uup+]<<<<<<<<<<<<<<<</<<<<<<<MHDFJBM7!+5#2-)+/'2 T;QN?QGEILAI9 63$6,*.1&.  +++++++++++++++++++++++++++++++++]34632#"&7327654'&#"4632#"&7327654'&#"4632#"&7327654'&#"@YaOA; +,"<>!-BOA; +-";>!-OA; +,"<>!-6 ǵǺŘj-/.>ǵƹŗk-=>/.>Y,&$@j!@4η A!)d+++5,&(kj*@ @ 4 / _  H+!)++]q+5Y,&$?j!@ 4 H+!)d+++5&(l<@4@ 4@4H+!)++]q+++55,&(Cj(@ o  @  H+ !)++]qq5,&,j+4@"%4/ZH+!)++]++5Y,&,j!@@344@4aH+ !)++++55&,@ H+ !)++556,&,Cj(@@4@"%4 H+!)++]++5c,&2j$@4pH+!)++q+5c,&2j@ !A"!)++5c,&2Cj$@ 4PH+!)++]+5",&8j+@@ 4O/H+!)++]qq+5",&8j@ H'!)++",&8Cj#@@4H+!)++]q+5z&&@ % +]<<??<1033ƴ&I@d<=@ 4dd<h+NM+?<]<<<10#3#XqT@@ :??@  v Mv!z++NEeD?M910Cy@, %&22  222 2+++++<<+++]&763232673#"'&#":9Y>k;# "mT?gC"h>>6#4rr8$/_#@45h+N/M+105!p˔.} KU @ @@ A+]NM?<,+?:IjkLMjkO/@@--@?k[A : OZ@ : vM>Wy+? @^&>k U4Ks u:A@!<r<rp+NM]?<<M[4z-cxYKDT.w"xeV(H@d<=@ 4dd<z+NM+/<]<<<1073#3gn+ z@     @!    T  e]  ;\+]<<<<]?9/9/?<<10573!!Lf5{|ҭ v@N p       E  @N  N GP+]]<<<<?9/9/?<10]5737#>nnss)\&&6(d@ 11H+4!)++]5?&V@ p11H+5")++q5)&&=d@ A!)++5(&]@ A")d++5QYOe~@# v  !++N]<H WXfh 7) $ "%?O!G7+]<<</l*Q {j=m@ u  a '? a@:) )'h+NM<?]99910q]q676$7654&#"'6632!)? %FDBA;-S#99V)+0>/CoivUTK8s=$y!+v@##M'0a)@ '_o?a@) ')&)'),h+NM?]r]9/99910732654&#"#7654&#"'6632#"&! +;GVHW QK<;8?)}xGCYT<N72<n<+%4,:jTkP7VeD]ok *@//,3!?&D!T!(((@!(),+   @ :Ma(b)b@ **' 'c@)":**)i, )D+Wh+<<<<?<<?<<<999999.+}10]]356673676$7654&#"'6632!M6fz>/l=*> %EEBA;-T#9 *Q {j=89W)+0=/BpivUTK8t=#yk @   )+::Vf fv@   @  :d@-' 5_5M  5 h+N]M<<<]<]<?<<<<<<<</lzhh9 *Q {j={l!-8;3/=@'=<% 23:% 1:20M @  0 @/?_o_oa a+@35449677/;9d0/.32@ 88.. 0@;1108:5363.)8N=)"" )0(((@ )")<|f+NM]<<?<<<<<<<<&V*@ 33333@ 43.&D@ 8'H'8 )++Z&&'dH+!!)++5G (@06'SS'bb'56-!: I CEI(Z j - # & C@C@@&H H @1#3   %@`t$?O)4+N]M]<<<<<&H='@`PH+ )++]]]5&&(3d*@ @ 4 / _  H+!)++]q+5K&H@  H'!")++*,&/Rj@  pH' !)++B&Od[+4@"%4/ZH+!)++]++5* h Q@/ee Qe     ;\+N]eclM,5F{"E*t0&&7d$@ @%'4@ 4H+ !)++++5# "@*ol```ppr   !-@$@3 @@$+!  "0@ %E#6f+N]M<<<??<<NM?<99993310]]53'667#"&&5#5373#32EHN-31LeclM,"&8@ h'!)++&X@ A"")++55",&8j @`UH+!)++]]55&X!@ 4dH+ ")+++54),&=j(@@ 4YH+!)+++]]5(&]OiH+")d++]5)&=0j  H+ !)++]5(&]'@ /H+")d++]q586@  ;+N @P "7GVVv u IFFI[TT[h h gy  %*5:o`  @'k@B7"@? O  4!]<q]33????9]10qr]q]3#&'!"326%"32654&F;F;+S}D|&~d^,!eg#ĿH,@;X Z Uh h xEJJUZ '(78E3993[  ko c `coo`~ __ P PP_ZP+k j @'{0@[k@@@$%40 1!@?1 ]]]+3/3/]99]r9]??3?3910q]]]r]]]q!!#"57&'32654&#"!dվ]Rzf@ Aʪܼ˼bc>$@7&_&}}&&!96"uy!!  @ 4? @ p  #@2  @ @"4  `&@O4%]]2/q3/+339/9??9/q3/]33/+3910]q]&#"327&#"327#"&547&54632={kXQxt# opM{h]^6F]nEGam~LSwD>@Y6699EEIISXTRT^ejdddm   $P`p0@P`p @ ?$ @$%4 ?  1]+q]]q???9310]!#"32"32654&߅#K_&|}±.&o@ P ` p O  p@+% p@p J/^]^rq]]]?L<;Ol#67!5!&&'VcM^g;L<;l%-0lea^vSh;5367#&&w^`elɐ/.%L;g^McVOn#67!#&&'56673!&'3^PE}}EP^^PE}}EP-++-,Ug3&'67#&&'5566-,,-+^PE~~DO^^OD~~EPg3&'67#&&'5566!!-,,-+3^PE~~DO^^OD~~EPbjk3!!jded#!F@  #!! "y+NM<32#4'.#"% D|wנE  5o\\s.mE}b]4t?rvLPh6r: j@< %?   %0%   WZ+N<<<<<<<<<</ON?2abu u??e!00!"//"!00!"//$$_dd #/! ! 4&#"326%4&#"3263267'#"'vu/"!00!"//"!00!"/2ba2?NOu u"//"!00!"//"!00_dd_$!FU/;3!!#&&''&&'!5!66776674#"32LfX"4I&P|9bkLpP3BD P BE0$e\$,-U?G5_J`]E2H9 Q>=3TjEjT9F=,-I '!!#!5!"&&546632"3254&&5;4gv~~n;I;yzzyoT&#"&&5432'"3254&&$93NXh v~~TfEK25yzzy:"#"&'!726'#"&54766766!lJ\N1K-TZ!-0IClE`a]c %%__[I;R6S73!!7676654'#"&54632&&5463267632#"&'&'J6Qg=[t^"#"3o|rvt3FG)rmYb(tx=3%X=)?&&'&'&&5463267632bsy.)mnQ=&!4/        ]@   ]/]@ ]  P`p]q<]<<?R>M[wh[|#N>CU.w=vgP~FfW@lOp ~ E  E % N]qr<<<M[uhet"N>CU.w&Q! A/+5]@c;4 ?A il{uru $$/q  /&  V ]<]/]/?@J$4Dr    %@364pE%@364 N 9]q+<<<]q+]q<<9?&U%/\&&6Ld@ 36A2!)++5?&V@ 36A2")++50@7  0     99   / s+]<]<]<<<<9999??<<999/<99<9910]!5!!5!!!!#JHu #&4@^#&4/ + +    3  "" %ENG +]q<<<<3/q993399??<<9/<<10]++#53#5373#3#327#"&&5%@ /I=jslU>Hu"&8d@ !A!)++5&X @@ST4%A")+++q5"&8d@ H+!)++5_&X@  A)++5"&8d@  A!)++5&X شH+")++5V""XX"$@*4:;4!6"JJF!F"XV!f"v" " 4]  @  ]@' &  P`p]$&  4]#;++]]]q9/]q3//]?M[vebyIt۴NG*GT.w=xeFqPO^NW&%ֵ "4'@ 4 4@@4 &5Dw*+ E #%   @pE %"!#0@%$@364$$$N'@464''p'''''%@364 N&GP+]q+]q+]q+<99/2//]<??L\uhbw|~;nS[0N>CU.wJ)yzk !-8@/:{wB\4@';4?%6a@ %/%?%%%+a@    }0a@  ")'.) @()'3)::9  )F9Wh+<<<99NM?<<<<99/]9/9/.+++}10]356673&54632#"&54732654&#"32654&#"M6fz7.l}F33IH67@GPVDFL9 *Q {m=/sPokVs-)j~d244-.7:E5:DE""6BMQ@/Oi&f*{&w*&*B\4@';4?!--:##Ka@ :/:?:::2@a(2a@ ! 0da!@/?_o_oa}Ea@2  7)%'C)5@/=)+'H)/OON)" )0(@' d)")N|h+NMr]9NM9?<l ` ٹ+9<</<<1053'67J^6]un&T(kk[K@ M   1@:M/8)j W+NM<]]10632#"'73254#"#|?M ,+2nHMt uLCO Z@8 @ P `  u@,/4_P/r]+q3/]3/?]q<<103#%3#%3#[u<֭[X@o/0gh ` YVPh               p@ RR@4@ 4T  @ eRP@ P    @ +]q]q]qr++?@'O_  b V b V ??9/]q10!!!!!!#^gyY&&c2"O @4 ]   @4]  P ` p ;Y+]q+]]???10+3!#!~F 3 @s 66   &- 7:? I ij xx            1  ]<<<9??<<9.+}ć.+}10]qrq]!!!55y <!/07F< I;0@i@O I@@`p  0@ 4 4## 44 ]     0 @ @ ` p  ]@ 4 ]]+]q]q9/<<????9/<<10]++q]33663#$uO sb ;5 a@[XYXW [TXXzu \P od v % KKFE   * ; --  ::/Ox@& Jj_ @x@&J` ]q]]]<]<<?<<<<<qui>@`rp %5F   %p  N%@364 N 9]q+<<<]<<9?9V=&)@ N% EG +]<<??<1033&& @:D? ZYii   (8XYJ@M  %%  e     Pp % @364   N ]q+</]9q?<RiE> @dk jj`_bjl blP__ P_9579IFFIVWX Y h x    $@$%40` 1@ #40 %@364 N]q+q+]]]+3/???910]]]]]q32#"'"32654&s#i."}@VQ>"@?')69 FJ   & 7 G v  ! $ @$%40    1$$@#40$$$@$%4?1#]+q+]]]+3/39/3??/10]]]&#"#"'732654&'&&54!2*pp‹|FަCU,:+`nO~Y${#t3%AsK S;69/d&@KDDTSP[cjs{ p  % p  N%@364 N]q+<<]<<?53#.5z05Mδȋ.&gYb ʗDW&$@I&( &9H@&S\]Sdknavzuz$$&&& HH   00@#  P  0 #@@)$%4 0 0 @`1&&@#40&&@#@$%4#?##1%]+q+]]]rq+9/qr99/9/????9/]910r]3326653326543#"'#"5c@p%%q@b۪ab&d~7{cհI"&@ H+ ")++55&#@p A")++]54D'&R@H+")++]5&# ")+W&&@ %' A%")++5&(^  !)+2@*fv" ]J  J@ & 7 T<9/???<9/9910Cy@  66 66++++]!!632#"'732654&#"#!2hLR8c˲!%^X U,&=j@ H+!)++5dv@+;]o )) ) 5;5 ;GKE KVT V Tj wyx   `p T   &&b/ -&  c\+]]]q9/??9/9/9/]10]q]!3 ! 4$32!"Y ^Y 836S Kt1GJ23\6,5&,@ H+ !)++557a- )&=@b&&  H@ !&@$%40 1( :J-']]+9/]<???9/10Cy@,$&&%%#&, !6$!6, 6"%6+++++++++++!2#!!#"'73265!26654&&#!^bɾ+j@Z!0"BBjzW]ohM wc)w`[{&@+    &@$%40 1! ] <]]+9/<<?32"'&#"#&&##"#67&&'&'&#5632kS=OW_  ]-.;@^Y.by`b .OdE?--YN e`P?Ti~iwQ--s&(Rer' k((OwdN&@SN9Fe!uKZt( @P`p ?O_%0@P% H %HH@% &K& ""\(&b&1']]9/??9/9/]9/]9]910Cy@#$6$66#6++++q]]q732654&##526654&#"'!2# N]mo32"'&#"#&&##…lT=OXp  ]-.;JfG.el~gĐwQ--a'{R[  b H@  ] : J b]???10Cy@ & ,,+++!#!#"'73265 +j@Z!0"BBF wc0"+c2!L @4 9   @4]  P ` p ]q+]]??<10+!#!#F 3fv&07 @>fh ] J H@   \\9/]9999??<<<9.+}ć.+}ć10r]r]33#"'53267 g{KmNWGg>~ք#-[R@M !!O!p!!!%++%{ {0 o   ?p &?o@ &0`p@   @    O  /]rD[D(@99 5%9'I F%H'YYU[Q%\' = & #3  & $@$%40 1*@#40***#$@$%4?1)]+]q+]]+???9910q]#"6632#"&!264&#"326 IsߢGDrp(2kTVeeO$ P໹&#@$%/%F#+##++ $$ @$%40    1%%@ #40%%%E$<q+]]]+]??9/9910Cy@3!%% & !   " <+++<++++++++]!2#!326654&##32674&&##k??Kc Ļ!sVDwrBju&3_Lq&^gI3TBGW3W&@+ %E]<??10!!#cQ&ol& @X +  + @    %+?ON+    <]qrrq]9/]q9/]]?<H`&8b@x' %%:/:?:`:p:: ::0:O:::::4;!!!533+)'))'+% !!%"#""#53') %# "7 @?.3 0 H"!! %'5)3/#! " @  (@ %8(@O//"""P"""p""""39]qrq]q<<]qq9999?<<<=eI%W7 QD2b>&@] (U ;P`p    @HH H ! $!$@$%40 1(@[']q]]+9/9??9/]q9/]9/q]910Cy@*$#&!$! "%<+++++++]]q5>54&#"'!2# 732654&&#"rrSJaM=P2~PPл:[[yLVq P\& @8Vg{+ %@364N @464 p  % @364   N ]q+]q+]q+99???DD /,//L^z KK ?{{%   @* H    I %@364 N]q+<]]99?<33'"#&&##VEC5BV_$2G+)DGtp;X=&5B~PmhP!Ic?#&@+3  %@364N@*464@`p%O_op | +9/]]q+q+??10Cy@ &% ++++!#!#"'532665D#lf?RO80&vX2& @r   FJEJ VZ      xx     @H ++      %N? % N ]<]]<9?<<R&d@+ %@364N @464  p  %@364 N]q+]q+]q+?SP>F&&O@/ 0 @ _ + WW@%PP`/]qr??<10]!!#!&_&o!Q&\KiJ)5@jX  77[\ USY Y"Y&U,V.U4jj edj n"n&h(f,e.f4yvy vv #0'33!3-  %$$@$$%40 17@7P7`7777 707@777@#4077*$@$%4?16]+q+]]]]+9/<<???l&&aTYEl& @+  + $@7$%40 1?_ %@364 N]q+<qr]]]+??9/10Cy@  ++++332#!732654&##>l&aTYEl+>S}@ 7N5>@q 4GZ_ PSS_[no eccon"+  $0$ @$%40    1!%@364 N ]q+<]]+9/]q<????9/10]q336632#"'##"32654&yڴZ|{&D*˷̽&@H 4 D [T y $  %    +   %N ($<9?<@:EUUk l ls s { tu_o "0@` @1 4+  $$7$@$%4?14 +N]+MV<L :&@ H+ ")++55Q:M&"@,$+"" ++ +  %@ `   $@$%40 1$$@#40$$ %O_#]q+]]]+9/]q<??<?9/10]32#!!#"'5326532654&##D> 'ohoG(?([k&a﯐G NnSZFk9&@&+ +  %/ $@$%40 1@ #40 % @364   N]q+<q+]]]+9/]<99<?fkl)&FgOTBe@  %5Fz@'+4    % @364   N@464p%@364 N]q+<<]q+]q+/]/?' &<<9/<99?<<1_u=3oZ\%)gvۍG2)1V@ Tc  ̴ 4 2/+3/2/?3//?<10]%3!5!4&&#"'63  BAjX1@Q#/8 4K Y j {  #      @ /]2}/]323/833/99?3??<<<|9/399.+}ć.+}10]#"#76634&&#"'632bI{R;TKIVG=0Ca4o[VY6 f-%.@  ̴ 0]]?+ ; @  3/3/?3??1088]63 #4&&#"(*Yzl+BPV7]@8JJ \\ YY*, ;;    ?  & ]3/]3<3//?3/?3/10]]77326654&#"'63 #"P^cqSd]u\ +]]o<F;@6DTu   ʵ 3/9/???10]!#546776655!3L*46Q31<,%pGHm|?L8ZG5910@CSf  ȳ ??10]!!6324&&#"9bֳb4Ui#sNuQ#P>1@ )6ZZij @?      ?_ 3/]3/9?<<?B H@*/7GSYY S S\\S  &Ƴ&??10]432#"732654&#"Zؔpј6u1%@J5 yyu u ;i  3/]3/9/3339/?<;+\%qHHn{mNL7YI(1B+ ; I @  / 3/]3/?3??1088]63 #4&&#"(B>k \d*%!x@M+/#15==1HHY\Zhjju r tvy! ! ! Ƶ# !"229/?<2 lg&&&&=3oZ\%)mpۜ>%%%%2)1& @ `A)++]51&F(@@$$ $P$$$$$A)++]q5-%&N @  A)++]5@1& @@pA)++]5%F @  @CD4@=5O@ /@4/+qqr++??/10#2#"&5466š%&5&%%q&&+)%;%"n@ $$Pb@1 '  @4O@4̳$ /]+/]q+3/9/??/]10]"#54'&547!5!2#"&&546; %&%0TfjJ1q&&&#1@;&@ (!A)++5%M @ @CD4@=5O@ /  @4 /+qqr++?3/]9/10#2#"&5466š51#5&%%+)#1,(&(h1&@ A)++5PV7&@"`"p"" A)++]5<F&9#!!@ 4!A)+++]5P>1&?@ %A)++5<<1&b' 4A)++]+5Z>B (@!/*\\S 7GSYY S S"@ / @&O&_&&&&&&Ƴ*&)9/]q??9/]qr10]]432#"732654&#"2#"&&546Zؔpј#%&%06u1Y&&&#1nh1(@ "4 4IK[)8=@!!l )  (4U@%@#&4%@4%% /ȳ* )]9/+++?3/?9/3/1088]]++327#"63 #4&&#"2#"&&5466&\-6D?~b %%&'z 5uN%%&%s7 -@MKz//==!@((l   #4>%@+@!#4+@4++& / .]9/+++3/3/?3/?3/9/3/10]]632!"'732654&#"327#"&52#"&546z8q.b¢TR{ 'Bb %0$#105G?Ĭ{I%$00$#1 f%&e@  AG )+q+5h%&3@#@>C4#@374#@4#p##A)++]q+++5(1&@ A)++5d*%!.@Z/0 yjju r tvHHY\Zh+15==1"@((! !%@o,,, 0! Ƶ0 !/229/]9/]?<2 lg=3oZ5k%)mpۜ>$  ///10#$H %@ MM  4@   @ 4ض@??4@44 @4@[\4@&)4@4" 4 @+-4  @ @+-4   @+34 +-4+-4ַ"+34/3/+]+]+2/+]+]+/+3/++++<<3/+++<+</10]r#'7'77'$H1111m1111 _@6 rrr  "()4@ 4/++<<</<<9//10'7!#!'71GQ11b1Q# z@. @ 4r  r  r   ޳()4@ 4 @ 4  +++<<</<9//10+#!'7!#G11Q11C 4 4  4/3/+9/9/3?3/++310#"&54767P?MfX+V!;75Tkp7=76(G660] 4 @ 4 @  4/3/+9/9/33/?2/]3/++310#"&54767#"&54632P?MfX+V!;7C00GF11B5Tkp7=76(G660"/EE/0DBC'3̳4@ 4@4@ 4 %@ 41+(. @@4""(.$/3/3/]3/+9/9/?2/+?9/++10++#"&54654&#"'4774'&'&54632#"&54632$)@2Bn@4AS*@* =J~ KxI41HI43F>/5B,DD"*I51Lt"izBR 48BpYol3IJ24IJy3$ 4!@4@4# 4# #   @ ##&@ 44 /9/+3+3/3/9/9/9/?3/92/9/+9/+910++'6767'&54767632&'&#"60bq] t3(0>PQK1 (4%='0h0%P+(#FZ/:@ 9 %# -3 4339%%## @9 0%5)#0 4005@ )@ 4)) 44/++2/93/+2/+9/99999?2/9/9/2/+9/9910'#67654&#"6763267&'&5476324&#"6V.:GW(  ."&E?'+5&G %A"  /)C6$B % #F7B*/ //4&U&F[E  4 $/<3/<?3/3/+2/10%4764764Z,S4Z,S[/,#Q,(";/-#R+*#Fb1#$/3/?3/104764Z,S1.-#Q,(#H(' !@ 4!!' ' @  '$$ $4$4$4$/+++2/3/2/99?3/9/3/+9910'##6767&'&54632'4&#"6S2J2I5G@!M-*  K& ,}$27H83'Be8()7 ]."F#$/3/?3/10%4764Z,S0,#P+("F(@%&!&@ 4&&! &%%4 4/++3/23/299?9/3/]3/+9/999910#"&'#"&546773276773276573 #** +  &K06 $ 922 $ #8K1 2(+/FQ -  /3/?2/10#"&546324&#"326Q\C66P;6Jb<6MwZWD-# | @  4 /3/99+/3/10&'&'667U0 U#"89&Wle0"D[v_1,.%; @ 4 @ 4 /3/+9/9+??9/10#474'&'&'7":-O(J`O0D#*ZwsԸ~@Z_Qs%! p@ @4@4 4@4@ 4/3/+9/9+3/++???9/9/+910#"'#'&&'7327677!49h 8&L0BC4_jp+ nBHP/OԲCU_.TK)k#]%) 4$$ @ &A   !!'&@ 4&&  @ 4 4/+3/+9/9]33/+9/????9/9/]9/910+#"&'##4'&'73276733273_c9T"hI% (8D4I4!\UUeJ9mL]o%XKFGLD??DY ")=9<3B#W !-.LdMbDG)+$ !HBAM)0 !@@@4 4@ 44/3//2/10+++#"'&547676324'&'&#"326guyFP,2FV\vJPCe]/B,$E?|zq*0[Qbx9B7-)ZIHR&#I@G(o( 4' 4 4 @ #@4##/3/3/+993/??9/+9/9910++&'&'&54767#"'&5465732767G&A!8$0J/0&$.jOcU .$+%=[o:=  N!"7%g3WAnWH%i@ 4&44 4@4@ 4   4 @    G/333/3/333?+??9/++9/10+++#'376)@ǣ$eb? 'YV^3=1o@T4&44 4 4 4  4@   G/333/3/333?+??9/++9/10+++&'#6763$1+ *[tG[WFV]) [/@Z'*. 8 P@ 4    /9/3/9//3//3/10]+#"&54632%##"&54632L76ML77L>mDL87JK66N7NO65JHGz6LL66ON0"9 4 4 @  /3/9/9/3?33/+3/+10'6765&'&54632&;"J*E)1%)K69VUI;9!777-( $<6MP:dgs 4#@2 4 #0qe6kY 4B 4YBGN,9ak*qFU;`kGq 4qqTGkkkN@ 4\ 4 \_QahKn? 4&@ 4?&,P333FGTUn`ah;*n,ah@ 4hh9,n@/3/+999992/q99++99993/q99++?3/]3/+9992/99++999999++10#"''#"'#"&5467'#"&54767&'#"&5463267&'&546327&'&5463267632676324&#"326d,!5JJ vV%4j  ! !$"!.0$VqC!;+!+*",k3=z;E(* 3#'"D6`*<  it8K`A2k۴qF,{@# 4 4! * @4 *@ !* 4.',/3/9/39/+399?9/?+9910++7#"&'#"'&54732654'&'326Bi\AJk0,Y/_=APM(0AWP)0@'1D=+Gжxiw%47_q 3'J|+CYRgJ@J-{#y 4 4  @@4@ 4###"/3/3/39/39++??9/9/9/9910++47"&54676632&&#"3267XGQNK;v-5sK IM1}l_V{-b^hDM-.?>/YJRV_ C26<"8"Xa!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ FW:ι@ @ 4 @ @ 4 $*783./#*//$88$$*3* @ 4 /.'$#877/#$$/.4. 4.$/++3/23/299/+<3/<?9/3/2/9/99993/+3/3/+3/10476476#"&'#"&5476773276773276573[,S\,S3! #)++   &W.+%P+(#>0%P+(#L06 " 91$$ #8K1 2)-1!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ %W/?10!5!WW%!!%!! @ !!%!! @ !!%!! @  $($44(4@ 44 4!#"$$%'&((@ o     A "$!##% &('%%A @*  4 */2/+2/9/9/993/993/99???93/]q993/993/9910+++++!"'&547673!54&'7'7'7''7Fr*9|oO6AM, DEJLJM"KN%CT]a#b..G8vA:p27pTVZU; µ44 @ 44 4  @ o   @ @ 4   */2/9/9/+993/993/99??3/]q993/993/9910++++%'7'7''7%!5!4'&'7JLJM"KNKNH8TVZUv>+Q[3M;!!!%!! @ !!%!! @ !!%!! @ !!%!! @ 6N u,04844.48@4) 4* 4y* 413244.57688-/.0@ 400  241335.0-//687@5@ 455 :'*/3/3/33/999]9/+993/993/99?9/99?999/+993/993/9910+]+++++"&#"676323263!3#"'&'&547676'7'7''7L@P4Z(#KB_Ep%Ӕ{F:؏XdOBFJ'F4@4J@4 4 * 4y 4GIHJJA?B@@CEF@DDD84=)%03"4-%%34=DFCEEAHJIGG@BA@?@4_????83@99""3433L))*/3/3/33/999]9/999/]+992/993/99??9/99?99999/]992/992/9910+]+++++#"&54767!3#"'&'&5476767&&#"67632326733'7'7''7{yf WXoF:؏XdUB%(Y$e?n"%SaM3a5()4!:2KUJLJM"KN%Zh':$4%DVll^ (0jyǫdSZ b&T%  8RۑTVZUyk"44"4! ""   "!@ T 4$/9/+9/9/993/993/99?<2/93/993/993/9910+++!5!&'&'&#"676323'7'7''7y%fFWHQS34/DhfEy+TN}Mb@()qzJUel/ *""sVj[Z4bZHnF)"+0s~9=XpTNT&m,!Z%E*ֳ4!4/4,40 4.@ 4;k= 4 44(4(ܳ 4(@ 4A(#A "  78@ (_((( ##8@AA 8G   4 */2/+9/9/9/]99?<TNѫF;@()XG=5!I/-=-{RZ,Q1 3ow%9=XpTNT&m,!)1YC.&Z4bZHnF:#0CA8<%Z9&3T)i? 1dk%m@4 4;k 44ܳ 4@ 4   @@o/_  */3/9/]]]99?TN}Mb@()qzJ%j[Z4bZHnF)"+0s~%d6ܹ/ֳ 4& 4441 45 43@ 4T+T2D+D2; k $ 4 4-4-ܳ 4-@ 4-"-(A ' "@ ---((8*/9/9/9/]99?<TN}Mb@()XG=5!e9&3T)i? 1dk)1YC.&Z4bZHnF)"+0CA8<%Z%,7@04/ 46 4@4 4;k 4*43 2 -... 4ܳ 4@ 4, A   %$ ,@ . 22@( A 9% $ 4$$( */2/+3/9/993/<?TN}Mb@()qzJUel/ *""sVJظ] j[Z4bZHnF)"+0s~9=XpTNT&m,!OYN?j$~FOZ%EP3@I4H 4O 4*ֳ4!4/4,40 4.@ 4;k= 4 44L#K"FGGG"(4(ܳ 4(@ 4A(#A "  78@ G#KK@ (_((( ##8@AA 8R   4 */2/+9/9/9/]993/<?<TNѫF;@()XG=5!I/-=-{RZ,Q1 3owظ] %9=XpTNT&m,!)1YC.&Z4bZHnF:#0CA8<%Z9&3T)i? 1dk˩OYN?j$~FO%m(@! 4' 4@4 4;k 4$#4ܳ 4@ 4  @ ##  @@o/_  **/3/9/]]]993/<?TN}Mb@()qzJaظ] %j[Z4bZHnF)"+0s~/OYN?j$~FO%d6A:A@4? 49 4@ 4/ֳ 4& 4441 45 43@# 4T+T2D+D2; k $ 4 4=(<'788'-4-ܳ 4-@ 4-"-(A ' @ 8(<<""@ ---((C*/9/9/9/]993/<?<TN}Mb@()XG=5!:ظ] e9&3T)i? 1dk)1YC.&Z4bZHnF)"+0CA8<%COYN?j$~FO2;&@4)44*4 4!' A 9' 4 03 @ ,$,@=! 4 $ 9/2/+3/3/99/??+??9910+++&&#"332!"'&54767673276654&##"&54767632 #a2W`X+5PHE`^f".<*?Cx+B71Cs}TePj6 @ 455@ 4,," 45& / @8  4 9/2/+9/9/??+9/9/+3/910+#"32!"'&54767327654&#&&#"&54767633])0Q0{@b(&%9zՏm#s?6I?3:??4HH44:C%%:,@ TKQKKQ @ QQ(?>743!HGG?/344?>4> 4>$/++3/23/2993/2/3/2/999?9/3/2/9/99993/+3/9/3/+99910"'&'#"&'6767&'&54632#"&'#"&547677327677327657'4&#"66#'#9<8L0: G-/   3! #**+   &Q#1  1& "!+U)# K06 " 82$$ #8K2 2)-1( F)1@&'"''"@ @4 @ 4 0*,,0.@**.@%(4.'&&4 4$/++3/23/299/+3/?3/3/++9/3/2/9/999910#"&'#"&5476773276773276574763 #**+  &3Z,S}K/5 " 82# $ !7J1 2),1/-$P+(#!!%!! @ !!%!! @ ///10#!$HbGQ$///105!#QHG !@   /<//<10###!!!HrG !@   ///10!!5!###rHGS@ ////<]10###!H @@  @4   /9=/<<//<+9=/<<<10#'77'$Hb ׶yyx #@    ///103#5!3###HGG)@     ///103#5!#3###HGGG !@   ///<10!!!##HFHS///<10#!$H,l@ /9=///<10##$HSW$'@ /<<//9/9/10##$HHH'88W' @   ///1053#5!#3WGBGGGW'///10#Hnw W$'@ ///10]#'$H'0W'///103!$'wGJ!'@/) !)i.@%) .0@>")> > i@)!?O>>>8H(y+?N]M]<]<M]<]<9999999910]'76327'#"''7&5432654&#"ՋsjitGGtijsGkklkwHHwn}~nwIIwn~}}llk #.48DHLRY`h@wz&S%c%#%3%C%Y=i=)=9=I=YAiA)A9AIAV;f;&;6;F;VCfC&C6CFCfhbdV`f`Y[i[**c*****u***3*C*S*cBB(-Wo]?]O]_]]]'VP(/(?(O((/ OGG23/3g<^P''O'_'' '0'@''R F"OM7K R6JMap999@9P9`999'W0^^'''_'o'@f''''$U-e-%-5-E--S++_oZP$$o!6 5## ! #j0eeo??????O??IJN/MMN1EQ2FN/]/]qr]q]]]q3]]]qr]]]/<<<<]]q]/<<<<]]q9/qq910]]q]]qq]]]]]]]]]]]]]]q]]#5#5!!5!#3#"'73253!5!!5353!#32##!!5!#"&54632#3!5!!334##324##32%#"32dCC?ddV4I(_tC~dYwdC~CddCdYeo|~ddd~C-Od?d ĺ[6.C?d{C~ddCcm !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ S0HH 44 4 /3/</3?310+++&'&'&4767670,h3g9JJ:f5d.l8<"8-}N౞Sy*K]SHW|@!!%!! @ % /|O@#%-.)$%!%%...@ 4!)!@c~9W=@C~~IIPPwccWCk55W==C%$ .--%$@%%c9Zg_@ccwPgg0TFI~}@TLPPT4T@ 4TTF5n0s ww00F/3/3/999/++3/99/9/9/993/2/23/293/2/?<<9/2/<9/9/9/9993/9/3/+2/]9/99993/3/9910&'&'632#"&'#"&5467732677327677"'&'#"&'#"&5467&&547673267&'&547673267&'&54767'3263 6 %%5)%  !** / & " wL=.(80?A{(p5p   C9.3'; $ 'B#:$X.4#72<Q=5-*$9 *jHk 6-- 0#U(()&%2&#;DL<;M!TL4"*"&RR{j70< '#*"%3wrI&.-'* )"+%"To #8 !y3 +@@?4  ?4 @ @ 4'$' @  $''/9/39/2/33//3/??93/+3/9/+99/+910#"'&#"'67632327'6654'&'667)02-c   & d2!54F2!31v ! $  PK(W L hu{,f-rt"%-@+-@?4--'+#"?4""'+@ 4   @--""## @ 4 /2/9/2/+3/33//3/??3/+3/9/+99/+910#"'&&'.'&'733#"'&#"'67632327D)$%  '{' "!b)02-c   & d2!54%70q{'0$xh|2* ! $  V n 44 4%$-0@ *4004$@  -00(%$$ (;/9/39/9/2/3/9/99??2/3+/9993}/+910++47&'&547632&#"326'6654'&'667n*d5;- $+]!2!31f @.#8> 4PK(W L hu{,f-rtV% 6 4,-@ *4--46!@  @ -,@ 4,,--&11 8;2/9/2/+9/2/3/9/99??2/3+/9993}/+10+47&'&547632&#"326#"'&&'.'&'733n*d5;- $+]!̌D)$%  '{' "!f @.#8> 470q{'0$xh|2*xcq *J͹-@ 4@ 4@ 4@ 4@+B2H0:@BBH@4HH0@ 400  %%!  @ @2==E++E006EE(( !L 4 ;/+39/2/2/3/9/99?2/?2/93/+3/+3/99910++++#"'&'&'73276767"'&547632&'&#"47&'&547632&#"326zBF3RAA8{1zmUU+OCL08VW&?')XM*d5;- $+]!a # >1]/j+1pgXfeO`% %13 @.#8> 4xcq-@R4@ 4@ @44  4%$-0 /$$@  (-00(%$$ (;/9/39/3/3/2/9/99?]?93/+]+3/+3/99910+47&'&547632&#"326'6654'&'667E*d5;- $+]!+2!317 @.#8> 4gPK(W L hu{,f-rtY@6@ 4,.4&@ ..4@444 4   @ ,))11"@1@ 41@ 411 @ 4 8;2/9/2/+2/++2/3/9/99??3/+]3/+3/99910+#"'&&'.'&'73347&'&547632&#"326D)$%  '{' "!*d5;- $+]!%70q{'0$xh|2* @.#8> 42q;[> 4&@4)44*4 4Q1Cs}TePk @.#8> 4j6V9 4 @ 4L7N>TIIQ77Q< 4%:Y ,@ 44 4" $*@ $$*@4**@ "' '''.;/2/9/9/2/3/9/99??3/3/+3/99910++!5!4'&'747&'&547632&#"326:KNHl*d5;- $+]!%v>+Q[3M @.#8> 4%:Y R3   /9/39/??910'6654'&'667R2!31$PK(W L hu{,f-rtY%<   @ @ 4 2/9/2/+??10#"'&&'.'&'733D)$%  '{' "!%70q{'0$xh|2* @ 44 4   A  A @"  4 */2/+2/9/9/99???93/9910++!"'&547673!54&'7'7Fr*9|oO6AM, DNJ%CT]a#b..G8vA:p27pT: ]4 4  */2/9/9/99??3/9910+!5!4'&'7'7:KNHfNJ%v>+Q[3MT: , '@ 4%% @ "")"(/3/9/9993/993/99?2/99+3/]993/9910'7'7#"'&54767'74'&'326NKALJ.GI07# !=#xWn/6- 908ːVTGn!=F\NO_T&?1 '#39?=%F%&/ @@ 4'+( . ((.ﵐ& @ @+#('  +1+/9/]999/993/99?2/]2/2/9993/+993/9910]'7'7#"'&'#"&5467&&5476733'32INKALJH7)\3s  !Wd"81<АVT[{\8>VND"*"$>t>DhmC7 %$@ 44 4@ @ 4 A    A @&  4 */2/+2/9/9/993/99???93/+993/9910++'7'7!"'&547673!54&'7%NKALJ`Fr*9|oO6AM, DVTzCT]a#b..G8vA:p27p%%:V{4 4     */2/9/9/993/99??3/]993/9910+'7'7!5!4'&'7NKALJKNHVT*v>+Q[3M%:V% (@ 444@ 4"4 4  @ @ 4 $A #$  $$##A @ *  4*/2/+2/9/9/993/993/99???93/+993/993/9910+++++'7'7'7!"'&547673!54&'7`MJhNKALJ`Fr*9|oO6AM, DcVVTzCT]a#b..G8vA:p27p%%:  @ 44@ 44 4         */2/9/9/993/993/99??3/]993/993/9910++++'7'7'7!5!4'&'74MJhNKALJKNHVVT*v>+Q[3M%: 6N u0@- 4* 4y. 4@ 4 #"$@"$##2 +*/3/3/33/999]9/99?9/99?999/+9910+]++'7"&#"676323263!3#"'&'&547676UM}L@P4Z(#KB_Ep%Ӕ{F:؏XdOB@ 4 * 4y 4A?@B@ 4BB84=)%03"4-%%34=@BA??83@99""3433D))*/3/3/33/999]9/999/99??9/99?99999/+9910+]++#"&54767!3#"'&'&5476767&&#"67632326733'7{yf WXoF:؏XdUB%(Y$e?n"%SaM3a5()4!:2KDMM%Zh':$4%DVll^ (0jyǫdSZ b&T%  8RUyk\  @ T 4/9/+9/9/99?<2/93/9910!5!&'&'&#"676323'7y%fFWHQS34/DhfEy+<KN%O,7J-Ad2m yTyk6N u,u@) 4* 4y* 4  @ .'*/3/3/33/999]?9/99?9910+]++"&#"676323263!3#"'&'&547676L@P4Z(#KB_Ep%Ӕ{F:؏XdO@ 4 * 4y@ 484=)%03"4-%%34=83@99""3433@))*/3/3/33/999]9/99??9/99?999910+]++#"&54767!3#"'&'&5476767&&#"67632326733{yf WXoF:؏XdUB%(Y$e?n"%SaM3a5()4!:2K%Zh':$4%DVll^ (0jyǫdSZ b&T%  8R%yk<  @ T 4/9/+9/?<2/910!5!&'&'&#"676323y%fFWHQS34/DhfEy+<%O,7J-Ad2m %yk6N 0@- 4* 4y. 4 #"$@"$##2 +*/3/3/33/999]9/99?9/99?993/9910+]++'7"&#"676323263!3#"'&'&547676MKL@P4Z(#KB_Ep%Ӕ{F:؏XdOH:%B-&>%)m-U%j%mf @     */39/9/9/99?2/9/3/9910]'7!"&546733!4'&'7NI@9[  *2>H:VB-&>%)m-U%F/pr@ * 4* 4 4 4@ 44 4  :  /32/9/??910++++++#"'&'&'73276654'&'7/^RztKEP=UHGB:~.%C9R',%nvhKH ( RK\OWFJLLVjF/pF/"@ * 4* 4 4 4@ 44 4 : $/32/9/3/99??93/9910++++++'7#"'&'&'73276654'&'7MK9^RztKEP=UHGB:~.%C9R',ȑTnvhKH ( RK\OWFJLLVjF/lWF@ 4@4! 4&4 4AAB:45,BB(55'( :, A145@ 455A ((''''#, @ 4 ABB?AAA=A @H  4*/]2/+2/]9/9/+<2/]9/9/+99??<?9?9/9/99/10++++#"&'###"'&546767327654'&'7327654&'732654'&'7O<[/*!/Z{,9ujt*$6(F-%5S2{_(#(%)K&C/ %!$& \WqBSFMVY6pE|CSdZGAR?Y4;# 7m>-Dq%5l Ro@ 44@ 4L 4*@4- 424 4  @ 4MMNF@A8NN4AA34 %+$F 8+ IM=@A@ 4AAM443333/8@ 4M(NN?MMMIA @ T% $ 4$$(*/]2/+2/]9/9/+<2/]9/9/+999/993/993/99??<?9?9/9/99/3/993/993/9910+++++++'7'7'7#"&'###"'&546767327654'&'7327654&'732654'&'7MJhNKALJO<[/*!/Z{,9ujt*$6(F-%5S2{_(#(%)K&C/ cVVTz!$& \WqBSFMVY6pE|CSdZGAR?Y4;#6'256 466B#&'@ 4''BCCB@ 4BB> I/2/+9/9/+99/+9999/993/993/99?<<?9/9/9/99993/993/993/9910++++'7'7'7#"&'##"'&'##5327654&'73327654&'732654'&'7gMJhNKALJM@\&/#3YA44"20PZQ#:) &.@CK$(*'":!)*A)cVVTz# %  $E:$<\*I%-9:"<^o+&!8> 7m>-Dq%l W1>@44 44 45-- <";2""2A @@  4 */2/+9/3/2/9/9??<?9?9/10+++!!"'&546767327654'&'73276767676324&#"!26 \rjt*$6(F-%5S2wfXaRAJYD?{RHY?aIH`r%hFMVY6pE|CSdZGAR?Y&!Gg4OI17 2&&'l W% >%0[ !))-  -& &2 /9/999?<2/9/9910!"'&'##5327654&'73276767676324&#"!26 N61%2*T\Q#:)#=AXTqzX QBJXE@zQdqpmd%$E;#l 5B̹@44 4 4 4"911!" @& @ ?6""!!&&6A @D  4 */2/+9/3/2/9/99/99??<?9?9/3/9910+++'7!!"'&546767327654'&'73276767676324&#"!26uLJ>\rjt*$6(F-%5S2wfXaRAJYD?{RHY?aIH`rdTlhFMVY6pE|CSdZGAR?Y&!Gg4OI17 2&&'l % )4z@ %  %--1 1 * *6 /9/9999/99?<2/9/993/9910'7!"'&'##5327654&'73276767676324&#"!26LJ N61%2*T\Q#:)#=AXTqzX QBJXE@zQdqpmddTl$E;#9/I  #- 1jC=ibI_NXAE%5,e/k^B_9/I  #- 1jC=ibI_NXAEȑT5,e/k^B_E&#8gM3I;P-8xYsωu]^-d" #i(`*/K1"C8\j/2DAQK]G % n4/  @4 4  /3/3/33/9+99?9/]?]9/910+##53&&54632&&#"66 Es$ś{P"QEn;cN]7K/w8v<b=21y//%mX(j@ $(4(  @$$$P  * /3/2/]9/9/9?<2/+9/9/99910#"'&'##532767'&#"#54763233mACP$CViZZTHRO* (:5qG]%H[%%BE&#8gM3I;P-8xȑTѠYsωu]^-d" #i(`*/K1"C8\j/2DAQK]G % !4@ /   @ 4 4 # /3/3/33/9+999/99?9/]?]9/93/]9910+'7##53&&54632&&#"66eKLFEs$ś{P"QEn;cNȑT@7K/w8v<b=21y//%m,@ ( ,  4 ,@$ (((P$$$$./3/2/]9/9/99/99?<2/+9/9/9993/9910'7#"'&'##532767'&#"#54763233LKACP$CViZZTHRO* (:5qG]%H[ȑT%BFUc,%h/"!)XHNYwQ(W[%~ *0G]jwubW/8)%1m%s%j%t@  # # @  4  !! '/9/99+9/99?2/2/993/9910'7!5!4'#"'&547632&'&#"326MJ)4.#I.528ZzB7*&#X4yVVYN %*Oht$%2-P%`!j@  4    #/9/99/99?2/93/2/9910+]'7!5!267&'&547632'&'&#" XSW>W33s7>Yf5*Z):(OK`~ 2xi]igP'K,L gw5BѳT  4@ 4!@ 41::)@@ @ 6 4&6#-==#A @D  4*/]2/+9/99+9/993/99??99/3/2/993/9910+++]'7'7!"'&54767327654&'#"'&547632'&'&#"326xNKALJz&#A* nfՠ &M'X7C:AYuD: *0-:%-"VTh]PWvxxF6J5C?>9FQ3-(0aqgt>).#$gw%j)@@ 4" '""'  @  4   %%  + /9/99+9/993/99?2/2/993/+993/9910'7'7!5!4'#"'&547632&'&#"326JNKALJ4.#I.528ZzB7*&#X4VTYN %*Oht$%2-P%`%@  4  " ""  ' /9/99/993/99?2/93/2/993/9910+]'7'7!5!267&'&547632'&'&#"5U}ViO{SW>W33s7>Yf5*Z):(ORQ 2xi]igP'K,L s%3(I84 @ /H# /&&&H@ @ 4 2:=>353%'IB@&>2SSQ!@ ('K-J.&D!OiN%mI#v@  4 4! 4   #    4 % /9/+99/9?<9/2/10+++#"'&'##5327676767'&'&'mhCTaJ:yt[G7-=YPCE)7s &0!$:%#=G7.$AXA:iTrG:8/2 !2'>%mIl{v$ 4@4 4 4 A ! @ 4!! A @&  4 */2/+2/9/9/+99??9?3/9910++++'7!"'&546767327654'&'7KHjt*$6(F-0S5($ViqFMVY6pE|CSfXN:Ql{v%:[ 4 4   */2/9/9/99??3/9910+'7!5!4'&'7LJKNH‘Tv>+Q[3M%:6 q=%F'n@ # & &@  #)# /9/]99?2/2/2/99910]#"'&'#"&5467&&5476733'32FH7)\3s  !Wd"81<%{\8>VND"*"$>t>DhmC7 Zp(5C@: 4:-=2-#4##--2 A @=:2)# 40##)00 )@ :@ 4:: 6E /3/9/+9/9/9+99999??9/2/3/+9/999+10#"'&'##53267&'&54677667&54767%4'&#"6764'&'326Z$'')pgGt5C[ZZ)LA c!E,@a{G^..Pz+8#3)%<=2 :GM40.B #/S7=ts+=+)C#J/51Umo)4&"."" 22@ *. &. &. * **6/9/9/9/3/999?<3/3/9910!#"'&57#536767632!%4#"6764'&'326m@-9@xdx#*5:C;/.(+<5[>H(t_\5@#%7EQN/;SdH]Pe@Jl=X7!C_^-i&,OI<nGVxc *u@ 4@ 4@ 4  %%!  (( !, 4 /+39/?2/?2/910+++#"'&'&'73276767"'&547632&'&#"zBF3RAA8{1zmUU+OCL08VW&?')Xa # >1]/j+1pgXfeO`% %13xc25j62V;?Cչ&@4)44*4 4<>?==@BCA!' A 9' 4 0=?<>>ACB@@$3 @ ,$,@E! 4 $ 9/2/+3/3/99/9/993/99??+??99?993/9910+++&&#"332!"'&54767673276654&##"&54767632'7'7 #a2W`X+5PHE`^f".<*?Cx+B71Cs}TePߐVTjN6:>33 @ 4:44,./4,,"@ >79::88;=>><58:799<>=0;; 4;;/& 4 / @ @@ 4@  4 9/2/+9/+9/+9/+]993/99?2/9?]993/]993/]9/+9/10]+++q#"32!"'&54767327654&#&&#"&54767633'7'7])0Q0{@b(&%9zՏm#s?6I+Q[3MDVTr:@DNe0@TVJOce@?4ee_c[WZ?4ZZS_WWc@'SS.<;K.7 4H7#K##@ 4##.KK?.@K@eeOZOZ[[#*7HK@@ ??<<;;  @ 4*E@ @ 4 @ 4 g@**/]3/++9/9/+2/3/93/3/9999993/33//3/???9/9/+]99+99993/3/9/+99/+910]'#656767&'&'&'&#"#"'&'&&5476326765'4674&'276#"'&#"'676323270;"%P&jruF #T!  /)-$ )NEUKIf-/C9,Kw:v2U)02-c   & d2!54F[~F(?A%4# LA[7<+#,'9.=+>#5NFreuJ^x!Bk,+$+/6'f$  ! $  @ >UH44ֳ4)ֳ 4(@ 4[+"@% 4+* 4*J 4)T 4(@ 4?SU@?4UUOSKGJ?4JJCOGGS@CC @ 4  0@ 4>03'&&>@ UU?J??JKK  4@ 4 7- 0033-77W&&/3/2/3/]99/+]+3992/33//3/?3/??9/+9/9/+92/3/9/+99/+910+++++]+++++&'&#"#"'&'&5432#"'&54&5!5$767654&'76733#"'&#"'67632327'8nzF:I,;)HtT3=`KY n!$)02-c   & d2!540}4#,:NX?[eW[n6ct& Q;^{bYT1"sc~6$ ! $  & DNn@Q@, 4TVJ<;K.7 4H7#K##@ 4##.K?K. 4..T?OdfVlTT4Tllf^@ 4^K@ dVaaiOOiTTZ@@ii#*7HK@@ ??<<;;  @ 4*E@ @ 4 @ 4 p@**;/]3/++9/9/+2/3/93/3/9999993/2/3/9/99??+2/3+/999?3/+9/9/+]99+999910]+'#656767&'&'&'&#"#"'&'&&5476326765'4674&'27647&'&547632&#"3260;"%P&jruF #T!  /)-$ )NEUKIf-/C9,Kw:v2U4*d5;- $+]!F[~F(?A%4# LA[7<+#,'9.=+>#5NFreuJ^x!Bk,+$+/6'f$  @.#8> 40  >^RA 4)ֳ 4(@ 4[+"@/ 4+* 4*J 4)T 4(@ 4  @ 4 @ 4> >03'&&>4@ 4DT?VF\DD4D\\VN@ 4N@ TFQQY??YDDJYY  4@ 4 7- 0033-77`&&;/3/2/3/]99/+]+3992/2/3/9/99?+2/3+/9993/++?3/?9/9/+9/+]910+++++]]+++&'&#"#"'&'&5432#"'&54&5!5$767654&'7673347&'&547632&#"326'8nzF:I,;)HtT3=`KY n!$=*d5;- $+]!0}4#,:NX?[eW[n6ct& Q;^{bYT1"sc~6$ @.#8> 4SDNn@Q@ 4TVJdOfVlT^@ffl@4ll@TTT@* 4TT<;K.7 4H7#K##@ 4##.KK?.K@ dVaaiOOiTTZ@@ii#*7HK@@ ??<<;;  @ 4*E@ @ 4 @ 4 p@**;/]3/++9/9/+2/3/93/3/9999993/2/3/9/99???9/9/+]99+99993/+]3/+3/99910]+'#656767&'&'&'&#"#"'&'&&5476326765'4674&'27647&'&547632&#"3260;"%P&jruF #T!  /)-$ )NEUKIf-/C9,Kw:v2U*d5;- $+]!F[~F(?A%4# LA[7<+#,'9.=+>#5NFreuJ^x!Bk,+$+/6'f$ P @.#8> 4A >^_A 444ֳ4)ֳ 4(@ 4[+"@ 4+* 4*J 4)T 4(@ 4T?VF\DN@ VV\@4\\D4D@ 4DD& @ 4  0@ 4>03'&&>@ TFQQY??YDDJYY-&  4@ 4 7- 0033-77`&&;/3/2/3/]99/+]+3999/2/3/9/99?3/??9/+9/9/+93/++3/+3/99910+++++]++++++&'&#"#"'&'&5432#"'&54&5!5$767654&'7673347&'&547632&#"326'8nzF:I,;)HtT3=`KY n!$*d5;- $+]!0}4#,:NX?[eW[n6ct& Q;^{bYT1"sc~6$ @.#8> 4SDN@)TVJ<;K.7 4H7#K##@ 4##.KK?.@K@ #*7HK@@ ??<<;;  @ 4*E@ @ 4 @ 4 P@**/]3/++9/9/+2/3/93/3/999999???9/9/+]99+999910]'#656767&'&'&'&#"#"'&'&&5476326765'4674&'2760;"%P&jruF #T!  /)-$ )NEUKIf-/C9,Kw:v2UF[~F(?A%4# LA[7<+#,'9.=+>#5NFreuJ^x!Bk,+$+/6'f$ A >44ֳ4)ֳ 4(@ 4[+"@- 4+* 4*J 4)T 4(@ 4 @ 4  0@ 4>03'&&>  4@ 4 7- 0033-77@&&/3/2/3/]99/+]+399?3/??9/+9/9/+910+++++]+++++&'&#"#"'&'&5432#"'&54&5!5$767654&'76733'8nzF:I,;)HtT3=`KY n!$0}4#,:NX?[eW[n6ct& Q;^{bYT1"sc~6$!!%!! @ !!%!! @ Fb1F=!!%!! @ !!%!! @ !!%!! @ FQ F!!%!! @ !!%!! @ HFZ!!%!! @ !!%!! @ !!%!! @ FIFWFKF=H@.J0wG!!%!! @ FF[!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ >@ 4 /3/9/?2/+?10#4'&'&54632#"&54632+9 %F79IH42HH42HCv~:~-=]\72HH23JJ"  /?10#"&54632O76LM58N6ON76ONW *  /3/?2/10#"&54632#"&54632N85LJ78NO75LK68N8NN87NN6ON76ON!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ %F/?10!5!FF%%F/?10!5!FF%%:/?10!5!::%c, 4'@4' 4 4 4 4@" 4(  % (,,&&@ 4& !!c-]/]+3/9/99???9/910+++++++3276'&#"%53#"$576!2676'+u߃&4Ŀ;_I[%rIѥ|B[Lly[h18-VD@,y@Y' 4 4 4@6 4)  % (,,&$ $@$%4!?!!1-]+/]3/9/99???9/910++++]327654'&#"%53#"'&763266'YTSYZTSYB&1v䅉ۋiD;lffmʿkfelѥ|BVHA'vm*ZU%Z4 4 @ 4&!@ %%&& &4]&+/<3/9/????9/910]++53# &53327636765$c24gs8$"}V[œFѥ> ~PRO]YcafNl*v&$u 4@,4 4    $$& 3%%@364 N%]q+/<3/9//????9/9910+++53#5#"&&'&533266536765\$\|]P #S:?Uѥ>GnO6r/T9a*vE+, 4S@`/]}?10+#'3/+, 4S@`/]}?10+#'3 #S 4@ 4//@ 4S@`p/]]/+]qr+10+#3 T+A44 4SO`/]+}?10++3#+@+84 4SO`/]+}?10+3#^+s #T4@ 4//@ 4SO`/]/+]qr+10+]3##),@ 4 @4 4%4@ 794@SZ4 @   W@ 4p/]+3/93/}?}++++]qr+9910+7676'&#"'6#55*[? 'i{NVp^ ^'*Ce2p m,q@* 4 @@|4@RU4@KL4@<>4@&64 @4  /3/93/+}?q+++++9/9910+7676'&#"'6#51'T< $b]  AZ?7,@ 4 @4 4%4@ 794@SZ4 @   W@ 4p/]+3/93/}?}++++]qr+9910+7676'&#"'6#55*[? 'i{NVp^ ^'*K]2pgm,q@* 4 @@|4@RU4@KL4@<>4@&64 @4  /3/93/+}?q+++++9/9910+7676'&#"'6#51'T< $b]  AZ?7I;0_ 4 @7 4 4  EE   @ 4?  v v@o/]3//]+qr3/]9/]2/10+++&6323273#"'&#"q[>k;#= ?gCNIf~6W8$_|+ٳK @ 4 4@@ @^5 @OS4 @CE4 @+-4o    @a  / O _  _ o   @5 @jl4 @a5 @\]4 @WY4 @MQ4 @DI4 @:5 @144 @.B4 @',4 @%4 4  /3/}/+++++++++++++]qr3/]q++++3/10++]&6323273#"'&#"q[>k;D= a?gCCN|R[,F,Lr s 4 @ 4 4  E@4!&4E / ? /  @ 4 @6>4?  v v@o/]3//]++qr3/]9/+]2/10+++&6323273#"'&#"sq[>k;#= ?gCN f~6W8$_f= 44 @#(4 /3/?q+10++&'3327673#"'&N;@AC@;OIMp#v#%H$&9O9@4 4/++9?r910#73#ЯC{{(@k;#= ?gCNIf~6W8$_I0k 4 @A 4 4  EE O  @ 4? O  v v@P/]]q3//]+qr3/]9/]2/10+++&6323273#"'&#"q[>k;#= ?gCNIf~6W8$_IM0k 4 @A 4 4  EE O  @ 4? O  v v@P/]]q3//]+qr3/]9/]2/10+++&6323273#"'&#"q[>k;#= ?gCNIf~6W8$_ri@2 4 4 4EE    @ 4 v v4 4o/]++3//+]r3/]9/]2/10+++&763232673#"'&#"s:9Y>k;# "mT?gC"h>>6#4rr8$/Hi@2 4 4 4EE    @ 4 v v4 4o/]++3//+]r3/]9/]2/10+++&763232673#"'&#":9Y>k;# "mT?gC"h>>6#4rr8$/ji@2 4 4 4EE    @ 4 v v4 4o/]++3//+]r3/]9/]2/10+++&763232673#"'&#"k:9Y>k;# "mT?gC"h>>6#4rr8$/}}J}{}}e} b#S 4@ 4//@ 4S@`p/]]/+]qr+10+#3  #T4@ 4//@ 4SO`/]/+]qr+10+]3##`i@2 4 4 4EE    @ 4 v v4 4o/]++3//+]r3/]9/]2/10+++&763232673#"'&#":9Y>k;# "mT?gC"h>>6#4rr8$/}_,}]vC}t}}l9}jX%}V]}},}*|+nK @ 4 4@@ @^5 @OS4 @CE4 @+-4o       /3/}?3/]q++++3/10++]46323273#"'&#"p[>k;D= a?gC@Q|R[,F,LI0k 4 @A 4 4  EE O  @ 4? O  v v@P/]]q3//]+qr3/]9/]2/10+++&6323273#"'&#"q[>k;#= ?gCNIf~6W8$_|4+nK @ 4 4@@ @^5 @OS4 @CE4 @+-4o       /3/}?3/]q++++3/10++]&6323273#"'&#"q[>k;D= a?gCCN|R[,F,LI40k 4 @A 4 4  EE O  @ 4? O  v v@P/]]q3//]+qr3/]9/]2/10+++&6323273#"'&#"q[>k;#= ?gCNIf~6W8$_<&C@5Op  % /]??10]rq33&Y&$}4 5<44A+++5J>&D}@ 99:/7A+]5Y,&$t@ ##"A+]5J &D4&@LpLLPL`LLLLLLʱH++]qr5Y+&$'|q0@*4H+A@(4/+5+5++]q5J#&D'KZ_BB@=4B;H+: :0:p::::::::@.24:=A>/>>_>>@ 4>/+]qr5++]qr5++]5Y+&$'|n'@H+A@(4/+5+5+]q5J#&D'-Y@E?@&34?@4?<H+: :0:p::::::::@.24:=A>/>>_>>@ 4>/+]qr5++]qr5+++5Y,&$'|u1)@4)))(AA@(4/+5+5+]q+5J,&D'tHb@ SOSSS@>4SR;/>>_>>@ 4>/+]qr5++]qr5++]q5Y+&$'|<0@"@ 4@4 AA@(4/+5+5+]++5J&D'ztT@A?O??I:=A: :0:p::::::::@.24:=A>/>>_>>@ 4>/+]qr5++]qr5+]5Yh&$'|}455<44@AA@ (4/+5+5+++5J&D'}C@0@@A/7A: :0:p::::::::@.24:=A>")+++]qr5+]5Y+&$'{q4#AB4#@95##H+A @-4 /+5+5+q++5J#&D'H7@ `HpHH[HH@4HCH+<<h+<")++]5++]q5Y+&$'{n?@#@894#@)14#@ 4@#o####@H+A @-4 /+5+5+q+++5J#&D'\*IPIIC@H+<<h+<")++]5+]5Y,&$'{u;@ 6666*246@!(465AA @-4 /+5+5+++r5J,&D't\B@0PZ`ZZZZZ0ZpZZZZZZZYA<<h+<")++]5+]qr5Y+&$'{P,@###/##-AA @-4 /+5+5+]q5J&D'z+F@ 4FP?9A<<h+<")++]5++5Yf&$'{}45$5<4$4@$%AA @ -4 /+5+5+++5J&D'}&@GGH/7A<<h+<")++]5+]5&(}\@    A+]5K>&H}P`ش A+]5,&(t A+5K &H*@2222221 A+]q5&(|j@  A !)++5K&H@ * A)++5+&('|q0@*4H+A@(4/+5+5++]q5K#&H'LK_((@/4(!H+ @;5 @-24  # A /  _  @ 4 /+]qr5+r++5++]5+&('|n4@%@:5H+A@(4/+5+5+]qr+5K#&H'.J@7%@&34%@4%"H+ @;5 @-24  # A /  _  @ 4 /+]qr5+r++5+++5,&('|u1&@ 4&&&%AA@(4/+5+5+]q+5K,&H'tHQ@ O9999@0498!"A @;5 @-24  # A /  _  @ 4 /+]qr5+r++5++]5+&('|P$@AA@(4/+5+5+q5K&H'ztE@3%O%%/ #A @;5 @-24  # A /  _  @ 4 /+]qr5+r++5+]5h&('|}\$@  AA@ (4/+5+5+]5K&H'}9P&`&@&'A @;5 @-24  # A$")++r++5+]5c,&,t: A+5 &@ O"H++q5&,} A+5|I&L}z@ @mo4O  A+q+5c&2}  A+5D'>&R}  A+5c,&2t8@p00000/A+]q5D' &R*@....-A+]q5c+&2'|qn0&&&@*4&H+!A@(4/+5+5++]q5D'#&R'MD_$$@)4$H+@.24A/_@ 4/+]qr5+r+5++]5c+&2'|n@4@%#@:5###### H+!A@(4/+5+5+]qr+5D'#&R'/C@1!@&34!@4!H+@.24A/_@ 4/+]qr5+r+5+++5c,&2'|u`16@ 46665!A!A@(4/+5+5+]q+5D',&R'tHL@ O55555@*454A@.24A/_@ 4/+]qr5+r+5++]5c+&2'| @#-!A!A@(4/+5+5+5D'&R'zt>@-!O!!+A@.24A/_@ 4/+]qr5+r+5+]5ch&2'|} @$% A!A@ (4/+5+5+5D'&R'})@"# A@.24A ")++r+5+5c,&jj@0o000%H+-!)++]q5D&k!@0O0_000%1H+-")++]q5c,&jCj @ ...%H+-!)++]q5D&kC!@_.o. .0..%H+-")++]q5cE&jt8@PAAAAAA@%%A+]q5D &k*@AAAAA@%%A+]q5c&jQ@ -9%%A-!)++5D&k@ -9%%A-")++5c&j}@ ../A+q5D@&k} ./A+5"&8}p@ OA+q5&&X}@P`p A+]5",&8t@ % A+]5 &X2@P------P-`-p-----@ 4-, A++]q5,&lj)'@95p'/'_'''H+&!)++]r+5&m@O(((E4@.34@$)4/@4@4@ 4/+]+]+q+++++]<++</<<10!5!#53#53u4 4@% 4@ 4?@ 4 @#%4@4 @9 4@4@Os4@>E4@.:4@$%4/@4@4@ 4/+]+]+q+r+++++<++</+]+++9910#7#53#53炇燇44  0444@#%4@ 4 @144 d4 @#%4@ 4@4@ 4? @ 4 @#%4@4@+,4 @: 4@4@Os4@>E4@.:4@$%4/@4@4@ 4/+]+]+q+r++++<+9+<++</+]++++++++99++910#53'#'37#53QȮؓɱbb4 @ @ 4 @ 4@ 4? @#%4@4 @9 4@4@Os4@>E4@.:4@$%4/@4@4@ 4/+]+]+q+r+++++<++</]+++9910#53'#'3#53`ؓ'  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ .nullnonmarkingreturnmu1pi1OhmEurodmacron overscoremiddotAbreveabreveAogonekaogonekDcarondcaronDslashEogonekeogonekEcaronecaronLacutelacuteLcaronlcaronLdotldotNacutenacuteNcaronncaron Odblacute odblacuteRacuteracuteRcaronrcaronSacutesacuteTcedillatcedillaTcarontcaronUringuring Udblacute udblacuteZacutezacuteZdotzdotGammaThetaPhialphadeltaepsilonsigmatauphi underscoredbl exclamdbl nsuperiorpeseta arrowleftarrowup arrowright arrowdown arrowboth arrowupdn arrowupdnbse orthogonal intersection equivalencehouse revlogicalnot integraltp integralbtSF100000SF110000SF010000SF030000SF020000SF040000SF080000SF090000SF060000SF070000SF050000SF430000SF240000SF510000SF520000SF390000SF220000SF210000SF250000SF500000SF490000SF380000SF280000SF270000SF260000SF360000SF370000SF420000SF190000SF200000SF230000SF470000SF480000SF410000SF450000SF460000SF400000SF540000SF530000SF440000upblockdnblockblocklfblockrtblockltshadeshadedkshade filledbox filledrecttriaguptriagrttriagdntriaglfcircle invbullet invcircle smileface invsmilefacesunfemalemalespadeclubheartdiamond musicalnotemusicalnotedblIJij napostropheminutesecond afii61248 afii61289H22073H18543H18551H18533 openbulletAmacronamacron Ccircumflex ccircumflexCdotcdotEmacronemacronEbreveebreveEdotedot Gcircumflex gcircumflexGdotgdotGcedillagcedilla Hcircumflex hcircumflexHbarhbarItildeitildeImacronimacronIbreveibreveIogonekiogonek Jcircumflex jcircumflexKcedillakcedilla kgreenlandicLcedillalcedillaNcedillancedillaEngengOmacronomacronObreveobreveRcedillarcedilla Scircumflex scircumflexTbartbarUtildeutildeUmacronumacronUbreveubreveUogonekuogonek Wcircumflex wcircumflex Ycircumflex ycircumflexlongs Aringacute aringacuteAEacuteaeacute Oslashacute oslashacute anoteleiaWgravewgraveWacutewacute Wdieresis wdieresisYgraveygrave quotereversed radicalex afii08941 estimated oneeighth threeeighths fiveeighths seveneighths commaaccentundercommaaccenttonos dieresistonos Alphatonos EpsilontonosEtatonos Iotatonos Omicrontonos Upsilontonos OmegatonosiotadieresistonosAlphaBetaDeltaEpsilonZetaEtaIotaKappaLambdaMuNuXiOmicronPiRhoSigmaTauUpsilonChiPsi IotadieresisUpsilondieresis alphatonos epsilontonosetatonos iotatonosupsilondieresistonosbetagammazetaetathetaiotakappalambdanuxiomicronrhosigma1upsilonchipsiomega iotadieresisupsilondieresis omicrontonos upsilontonos omegatonos afii10023 afii10051 afii10052 afii10053 afii10054 afii10055 afii10056 afii10057 afii10058 afii10059 afii10060 afii10061 afii10062 afii10145 afii10017 afii10018 afii10019 afii10020 afii10021 afii10022 afii10024 afii10025 afii10026 afii10027 afii10028 afii10029 afii10030 afii10031 afii10032 afii10033 afii10034 afii10035 afii10036 afii10037 afii10038 afii10039 afii10040 afii10041 afii10042 afii10043 afii10044 afii10045 afii10046 afii10047 afii10048 afii10049 afii10065 afii10066 afii10067 afii10068 afii10069 afii10070 afii10072 afii10073 afii10074 afii10075 afii10076 afii10077 afii10078 afii10079 afii10080 afii10081 afii10082 afii10083 afii10084 afii10085 afii10086 afii10087 afii10088 afii10089 afii10090 afii10091 afii10092 afii10093 afii10094 afii10095 afii10096 afii10097 afii10071 afii10099 afii10100 afii10101 afii10102 afii10103 afii10104 afii10105 afii10106 afii10107 afii10108 afii10109 afii10110 afii10193 afii10050 afii10098 afii00208 afii61352sheva hatafsegol hatafpatah hatafqamatshiriqtseresegolpatahqamatsholamqubutsdageshmetegmaqafrafepaseqshindotsindotsofpasuqalefbetgimeldalethevavzayinhettetyodfinalkafkaflamedfinalmemmemfinalnunnunsamekhayinfinalpepe finaltsaditsadiqofreshshintav doublevavvavyod doubleyodgeresh gershayim newsheqelsign vavshindot finalkafshevafinalkafqamats lamedholamlamedholamdageshaltayin shinshindot shinsindotshindageshshindotshindageshsindot alefpatah alefqamats alefmapiq betdagesh gimeldagesh daletdageshhedagesh vavdagesh zayindagesh tetdagesh yoddageshfinalkafdagesh kafdagesh lameddagesh memdagesh nundagesh samekhdagesh finalpedageshpedagesh tsadidagesh qofdagesh reshdagesh shindageshtavdagesvavholambetrafekafrafeperafe aleflamedzerowidthnonjoinerzerowidthjoinerlefttorightmarkrighttoleftmark afii57388 afii57403 afii57407 afii57409 afii57440 afii57451 afii57452 afii57453 afii57454 afii57455 afii57456 afii57457 afii57458 afii57392 afii57393 afii57394 afii57395 afii57396 afii57397 afii57398 afii57399 afii57400 afii57401 afii57381 afii57461 afii63167 afii57459 afii57543 afii57534 afii57494 afii62843 afii62844 afii62845 afii64240 afii64241 afii63954 afii57382 afii64242 afii62881 afii57504 afii57369 afii57370 afii57371 afii57372 afii57373 afii57374 afii57375 afii57391 afii57471 afii57460 afii52258 afii57506 afii62958 afii62956 afii52957 afii57505 afii62889 afii62887 afii62888 afii57507 afii62961 afii62959 afii62960 afii57508 afii62962 afii57567 afii62964 afii52305 afii52306 afii57509 afii62967 afii62965 afii62966 afii57555 afii52364 afii63753 afii63754 afii63759 afii63763 afii63795 afii62891 afii63808 afii62938 afii63810 afii62942 afii62947 afii63813 afii63823 afii63824 afii63833 afii63844 afii62882 afii62883 afii62884 afii62885 afii62886 afii63846 afii63849uni202Auni202Buni202Duni202Euni202Cuni206Euni206F;uni206Auni206Buni206C;uni206DuniF00AuniF00BuniF00CuniF00DuniF00EuniFFFC afii63904 afii63905 afii63906 afii63908 afii63910 afii63912 afii62927 afii63941 afii62939 afii63943 afii62943 afii62946 afii63946 afii62951 afii63948 afii62953 afii63950 afii63951 afii63952 afii63953 afii63956 afii63958 afii63959 afii63960 afii63961 afii64046 afii64058 afii64059 afii64060 afii64061 afii62945 afii64184 afii52399 afii52400 afii62753 afii57411 afii62754 afii57412 afii62755 afii57413 afii62756 afii57414 afii62759 afii62757 afii62758 afii57415 afii62760 afii57416 afii62763 afii62761 afii62762 afii57417 afii62764 afii57418 afii62767 afii62765 afii62766 afii57419 afii62770 afii62768 afii62769 afii57420 afii62773 afii62771 afii62772 afii57421 afii62776 afii62774 afii62775 afii57422 afii62779 afii62777 afii62778 afii57423 afii62780 afii57424 afii62781 afii57425 afii62782 afii57426 afii62783 afii57427 afii62786 afii62784 afii62785 afii57428 afii62789 afii62787 afii62788 afii57429 afii62792 afii62790 afii62791 afii57430 afii62795 afii62793 afii62794 afii57431 afii62798 afii62796 afii62797 afii57432 afii62801 afii62799 afii62800 afii57433 afii62804 afii62802 afii62803 afii57434 afii62807 afii62805 afii62806 afii57441 afii62810 afii62808 afii62809 afii57442 afii62813 afii62811 afii62812 afii57443 afii62816 afii57410 afii62815 afii57444 afii62819 afii62817 afii62818 afii57445 afii62822 afii62820 afii62821 afii57446 afii62825 afii62823 afii62824 afii57447 afii62828 afii57470 afii62827 afii57448 afii62829 afii57449 afii62830 afii57450 afii62833 afii62831 afii62832 afii62834 afii62835 afii62836 afii62837 afii62838 afii62839 afii62840 afii62841 glyph1021 afii57543-2 afii57454-2 afii57451-2 glyph1025 glyph1026 afii57471-2 afii57458-2 afii57457-2 afii57494-2 afii57459-2 afii57455-2 afii57452-2 glyph1034 glyph1035 glyph1036 afii62884-2 afii62881-2 afii62886-2 afii62883-2 afii62885-2 afii62882-2 afii57504-2 afii57456-2 afii57453-2 glyph1046 glyph1047 afii57543-3 afii57454-3 afii57451-3 glyph1051 glyph1052 afii57471-3 afii57458-3 afii57457-3 afii57494-3 afii57459-3 afii57455-3 afii57452-3 glyph1060 glyph1061 glyph1062 afii62884-3 afii62881-3 afii62886-3 afii62883-3 afii62885-3 afii62882-3 afii57504-3 afii57456-3 afii57453-3 glyph1072 glyph1073 afii57543-4 afii57454-4 afii57451-4 glyph1077 glyph1078 afii57471-4 afii57458-4 afii57457-4 afii57494-4 afii57459-4 afii57455-4 afii57452-4 glyph1086 glyph1087 glyph1088 afii62884-4 afii62881-4 afii62886-4 afii62883-4 afii62885-4 afii62882-4 afii57504-4 afii57456-4 afii57453-4 glyph1098 glyph1099 glyph1100 glyph1101 glyph1102 glyph1103 glyph1104 glyph1105 glyph1106 glyph1107 glyph1108 glyph1109 glyph1110 glyph1111 glyph1112 glyph1113 glyph1114 glyph1115 glyph1116 glyph1117 glyph1118 glyph1119 glyph1120 glyph1121 glyph1122 glyph1123 glyph1124 glyph1125 glyph1126 afii57440-2 afii57440-3 afii57440-4OhornohornUhornuhornf006f007f009combininghookabovef010f013f011f01cf015combiningtildeaccentf02cdongsignonethird twothirdsf008f00ff012f014f016f017f018f019f01af01bf01ef01ff020f021f022combininggraveaccentcombiningacuteaccentf01dcombiningdotbelowf023f029f02af02bf024f025f026f027f028f02df02ef02ff030f031 Adotbelow adotbelow Ahookabove ahookaboveAcircumflexacuteacircumflexacuteAcircumflexgraveacircumflexgraveAcircumflexhookaboveacircumflexhookaboveAcircumflextildeacircumflextildeAcircumflexdotbelowacircumflexdotbelow Abreveacute abreveacute Abrevegrave abrevegraveAbrevehookaboveabrevehookabove Abrevetilde abrevetildeAbrevedotbelowabrevedotbelow Edotbelow edotbelow Ehookabove ehookaboveEtildeetildeEcircumflexacuteecircumflexacuteEcircumflexgraveecircumflexgraveEcircumflexhookaboveecircumflexhookaboveEcircumflextildeecircumflextildeEcircumflexdotbelowecircumflexdotbelow Ihookabove ihookabove Idotbelow idotbelow Odotbelow odotbelow Ohookabove ohookaboveOcircumflexacuteocircumflexacuteOcircumflexgraveocircumflexgraveOcircumflexhookaboveocircumflexhookaboveOcircumflextildeocircumflextildeOcircumflexdotbelowocircumflexdotbelow Ohornacute ohornacute Ohorngrave ohorngraveOhornhookaboveohornhookabove Ohorntilde ohorntilde Ohorndotbelow ohorndotbelow Udotbelow udotbelow Uhookabove uhookabove Uhornacute uhornacute Uhorngrave uhorngraveUhornhookaboveuhornhookabove Uhorntilde uhorntilde Uhorndotbelow uhorndotbelow Ydotbelow ydotbelow Yhookabove yhookaboveYtildeytildeuni01CDuni01CEuni01CFuni01D0uni01D1uni01D2uni01D3uni01D4uni01D5uni01D6uni01D7uni01D8uni01D9uni01DAuni01DBuni01DC\ N$7<  h$$7h$9h$:$D:A:E-:H:I:K:L`:M:N:Q`:W:Z:l:m:n:w-;:;A;H;K;L;M;N;O;Q;T;W;Y;e;m<:<><@<A<E<H<K<Lw<M<N<O<Q<T<Y<^<f<l<m<o<q<y===w=w==:w=>w=A=E=F=H=K=Y=Z=\=^w=_w=b=e=f=g=hw=j=mw=u=v=x=yw>M>N>Q>aD>h>m-?A?k@A@H@K@L@M-@T-@Z@_@h@mAEAHAKALAMANAQAYDADHDKDMDNENE[EmFNFQFZF_FhFkFmFqFwH:H>H@HEHMHOHQHYH^HeHoJ}J}JJJJ:wJ>wJ@JAJEJFJHJKJLJMJNJOJYJZJ^`J_JhJwJyK:K>KAKEKFKHKLKMKOKQKTKWKZK`-KqLLLLLL:L>L@LALELHLNLYLZL\L_LbLdLeLfLh`LiLjLkLmLoLsLuLvLxLyMMMMMMMM:wM>MAMEMHMNMWMYM[M\M]M^`M_wM`MaMbMcMdMewMfMgMhwMiMjMkwMoMpMrMsMxMywN:N>NENLNMNQNYNeOAOHOKONOWOhOmPHPZ-SZSm-TwTYV`V:V>V@VAVEVFVHVKVL3VOVQ`VWVYW>W@WAWEWOWYW^W`WeWfWyX:X>X@XEXHXKXLXOXQX^XeXfZaZlZmZq[Z[^[_[`[a[e[f[k[m[n[o[q[t[w[y\Z\[\^\_\`\a\e\f\h\k\l\m\n\q\t\y]]]Z]^]_]a]e]h]k]y^t^w_[_^_`_a_e_l_m_o_q`[`m`q`t-a[a^a_aaaeahakamanaqatdZ-d[-d_dadedhdkdldmdweheqf[fafmh^h`hahehlhmhohqj^jajejljmjojqjyk`khkqkwlllZl^l_l`Dlelhlklmm3m3mmZm[m^m_m`memfmhmjmkmnmwmyn[n^nenlnmnqnyoZo[o_oaohokolonoqp_paphpks_shsmvl`vqww^w_wawewhwlwowyx^x`xexfxlxoxq33``.13 "&+M"9&@M Arial ?ARLR00@0 *H 010 *H 0` +7R0P0, +7<<<Obsolete>>>0 0 *H RXZqՁ&?00)ъĽ5ǛSV0  *H 010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.0 970512070000Z 991231070000Z010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.00  *H 0. h|,-.  WSu3* [4 Z%}XsjxqX)X^-bXq"X/6MJ;"V~!lJGj6 -Ӵ90  *H :>{թy=q#+(ߌe,ZbVkbEƢ5"r-| CMlX 5ʉp*}a qfbB="2"d$006C!FXF%`0  *H 010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.0 970512070000Z 991231070000Z01'0%U VeriSign Time Stamping Service10U VeriSign Trust Network1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.10U VeriSign, Inc.10UInternet00  *H 0aGܴ^i b1FI:?xZcEO n06- o' Q`5OTOз,B Ѝ^㖴"IBlӘV.:X"e匫xGBh[-}0  *H m`_i{p+b#D Q#tI'\q5+ൖ苧KsH ڋ %VNGWF8V!&;-%2Λ@GmGv0;~*1+ݰUApF-,~0 0 yfnжneq0  *H 0a10UInternet10U VeriSign, Inc.1301U *VeriSign Commercial Software Publishers CA0 980416000000Z 990416235959Z0]10UInternet10U VeriSign, Inc.1301U *VeriSign Commercial Software Publishers CA1F0DU =www.verisign.com/repository/CPS Incorp. by Ref.,LIAB.LTD(c)961>0<U 5Digital ID Class 3 - Microsoft Software Validation v21 0 UUS10U Washington10URedmond10UMicrosoft Corporation10U Microsoft Corporation0 0  *H  0&dm{AO o*q.S26h5IؖeS zpm̳*02X|k%gw #1 00u0a10UInternet10U VeriSign, Inc.1301U *VeriSign Commercial Software Publishers CAyfnжneq0 *H 0 *H  1  +70 +7 10  +70 *H  1 {r޹0N +7 1@0>Arial font$"http://www.microsoft.com/truetype/0  *H 4G/[R]m7#WHL0MZ ً ~$߆sw7,VlcT$ 0XnhȚsQٝ*2FgХ73|R9tRJƅpNagY3 NC >B"F/fg{ܧs>h3/Edu*qnI>|_(x]vga:e>YwBrj6`)@ш iڷ4/ևU 1 桂0 *H  100010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.C!FXF%`0 *H Y0 *H  1  *H 0 *H  1 981016201505Z0 *H  1/b){Z8*Z=0  *H JQA}YD (؁3=R„Mpjh4BF9] W\Z ‚ob!|W]}0%|rFUxZLGʀMAV,ݫOI$   "'6GK|}  LNgi $Xarabinitmedi fina&liga, 6<!)/3'-1<"*04'-1`- (,.26-'+-15 X 6  & : &,GHIJKarab ghi endstream endobj 58 0 obj << /FontFile2 59 0 R /Type /FontDescriptor /Ascent 811 /CapHeight 689 /Descent 189 /Flags 34 /FontBBox [ -101 -251 1000 1000 ] /FontName /Arial_Bold012 /ItalicAngle 0 /StemV 0 >> endobj 59 0 obj << /Length 284560 /Length1 284560 >> stream pDSIGR?GDEFQQ7TGSUBTJSTFm*iWpLTSH&XOS/2 3VPCLTAG?6VDMXVp]cmapܣ1cvt ؔ88fpgmGgasp Pglyf~(ިhdmx׏yheadǜfY|6hhea$hmtxRp:kernAON*PZlocaDDmaxp  namev`/WpostƬ%<1prepol].5_<<KEb >NCQE <c/AMl33f zMono Q3>@ _z Xh|&p    b fD \^9>,B n x b E aJ 1 3 Z.i   7  5 ? XG     &  W b  f {   \' ' ' ( (+ (I (Q(e(u(((((() ))5)C)] )q )))) ))$ )$)** **- *)-*3 *I *W*q* * * * *Typeface The Monotype Corporation plc. Data The Monotype Corporation plc/Type Solutions Inc. 1990-1992. All Rights ReservedArialBoldMonotype:Arial Bold:Version 2.76 (Microsoft)Arial BoldVersion 2.76Arial-BoldMTArial Trademark of The Monotype Corporation plc registered in the US Pat & TM Off. and elsewhere.Monotype TypographyMonotype Type Drawing Office - Robin Nicholas, Patricia Saunders 1982Contemporary sans serif design, Arial contains more humanist characteristics than many of its predecessors and as such is more in tune with the mood of the last decades of the twentieth century. The overall treatment of curves is softer and fuller than in most industrial style sans serif faces. Terminal strokes are cut on the diagonal which helps to give the face a less mechanical appearance. Arial is an extremely versatile family of typefaces which can be used with equal success for text setting in reports, presentations, magazines etc, and for display use in newspapers, advertising and promotions.http://www.monotype.com/html/mtname/ms_arial.htmlhttp://www.monotype.com/html/mtname/ms_welcome.htmlNOTIFICATION OF LICENSE AGREEMENT This typeface is the property of Monotype Typography and its use by you is covered under the terms of a license agreement. You have obtained this typeface software either directly from Monotype or together with software distributed by one of Monotypes licensees. This software is a valuable asset of Monotype. Unless you have entered into a specific license agreement granting you additional rights, your use of this software is limited to your workstation for your own publishing use. You may not copy or distribute this software. If you have any question concerning your rights you should review the license agreement you received with the software or contact Monotype for a copy of the license agreement. Monotype can be contacted at: USA - (847) 718-0400 UK - 01144 01737 765959 http://www.monotype.comhttp://www.monotype.com/html/type/license.htmlTypeface The Monotype Corporation plc. Data The Monotype Corporation plc/Type Solutions Inc. 1990-1992. All Rights ReservedArialBoldMonotype:Arial Bold:Version 2.76 (Microsoft)Arial BoldVersion 2.76Arial-BoldMTArial Trademark of The Monotype Corporation plc registered in the US Pat & TM Off. and elsewhere.Monotype TypographyMonotype Type Drawing Office - Robin Nicholas, Patricia Saunders 1982Contemporary sans serif design, Arial contains more humanist characteristics than many of its predecessors and as such is more in tune with the mood of the last decades of the twentieth century. The overall treatment of curves is softer and fuller than in most industrial style sans serif faces. Terminal strokes are cut on the diagonal which helps to give the face a less mechanical appearance. Arial is an extremely versatile family of typefaces which can be used with equal success for text setting in reports, presentations, magazines etc, and for display use in newspapers, advertising and promotions.http://www.monotype.com/html/mtname/ms_arial.htmlhttp://www.monotype.com/html/mtname/ms_welcome.htmlNOTIFICATION OF LICENSE AGREEMENT This typeface is the property of Monotype Typography and its use by you is covered under the terms of a license agreement. You have obtained this typeface software either directly from Monotype or together with software distributed by one of Monotypes licensees. This software is a valuable asset of Monotype. Unless you have entered into a specific license agreement granting you additional rights, your use of this software is limited to your workstation for your own publishing use. You may not copy or distribute this software. If you have any question concerning your rights you should review the license agreement you received with the software or contact Monotype for a copy of the license agreement. Monotype can be contacted at: USA - (847) 718-0400 UK - 01144 01737 765959 http://www.monotype.comhttp://www.monotype.com/html/type/license.htmlNegretaArial Negretatu nArial tu nfedArial fedFettArial FettArial Typeface The Monotype Corporation plc. Data The Monotype Corporation plc/Type Solutions Inc. 1990-1992. All Rights ReservedArialBoldMonotype:Arial Bold:Version 2.76 (Microsoft)Arial BoldVersion 2.76Arial-BoldMTArial Trademark of The Monotype Corporation plc registered in the US Pat & TM Off. and elsewhere.Monotype TypographyMonotype Type Drawing Office - Robin Nicholas, Patricia Saunders 1982Contemporary sans serif design, Arial contains more humanist characteristics than many of its predecessors and as such is more in tune with the mood of the last decades of the twentieth century. The overall treatment of curves is softer and fuller than in most industrial style sans serif faces. Terminal strokes are cut on the diagonal which helps to give the face a less mechanical appearance. Arial is an extremely versatile family of typefaces which can be used with equal success for text setting in reports, presentations, magazines etc, and for display use in newspapers, advertising and promotions.http://www.monotype.com/html/mtname/ms_arial.htmlhttp://www.monotype.com/html/mtname/ms_welcome.htmlNOTIFICATION OF LICENSE AGREEMENT This typeface is the property of Monotype Typography and its use by you is covered under the terms of a license agreement. You have obtained this typeface software either directly from Monotype or together with software distributed by one of Monotypes licensees. This software is a valuable asset of Monotype. Unless you have entered into a specific license agreement granting you additional rights, your use of this software is limited to your workstation for your own publishing use. You may not copy or distribute this software. If you have any question concerning your rights you should review the license agreement you received with the software or contact Monotype for a copy of the license agreement. Monotype can be contacted at: USA - (847) 718-0400 UK - 01144 01737 765959 http://www.monotype.comhttp://www.monotype.com/html/type/license.htmlNegritaArial NegritaLihavoituArial LihavoituGrasArial GrasFlkvrArial FlkvrGrassettoArial GrassettoVetArial VetHalvfetArial HalvfetPogrubionyArial PogrubionyNegritoArial Negrito>;C68@=K9Arial >;C68@=K9Tu nArial Tu nFetArial FetKal1nArial Kal1nKrepkoArial Krepko#mArial #mLodiaArial LodiaNegritaArial NegritaNegritoArial NegritoNegritaArial NegritaGrasArial Gras &&~ #~ O\_ :Rkmq~    " & . 0 3 : < > D o  !!!!"!&!.!T!^!!"""""""")"+"H"a"e###!%%% %%%%%$%,%4%<%l%%%%%%%%%%%%%%%&<&@&B&`&c&f&k:1 6<>ADOY}b?  #~Q^ !@`mq~   & * 0 2 9 < > D j  !!!!"!&!.!S![!!"""""""")"+"H"`"d### %%% %%%%%$%,%4%<%P%%%%%%%%%%%%%%%&:&@&B&`&c&e&j: *8>@CFVz^>/wkri+*)(i3][w}ujy,ߨߖޖޢދަq_0@3$FE<9630)"ۿ۾۷ۥۯEBA$"!9>c$FxFJXZV^^HHJF ^bcdefghjikmlnoqprsutvwxzy{}|~      !"#$%&'()*+,  -   ./0 !"12#3$%&'()*+   4NORPQUVWXST~?Avw|qrsYZ[\]uwvyx}  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&&~ #~ O\_ :Rkmq~    " & . 0 3 : < > D o  !!!!"!&!.!T!^!!"""""""")"+"H"a"e###!%%% %%%%%$%,%4%<%l%%%%%%%%%%%%%%%&<&@&B&`&c&f&k:1 6<>ADOY}b?  #~Q^ !@`mq~   & * 0 2 9 < > D j  !!!!"!&!.!S![!!"""""""")"+"H"`"d### %%% %%%%%$%,%4%<%P%%%%%%%%%%%%%%%&:&@&B&`&c&e&j: *8>@CFVz^>/wkri+*)(i3][w}ujy,ߨߖޖޢދަq_0@3$FE<9630)"ۿ۾۷ۥۯEBA$"!9>c$FxFJXZV^^HHJF ^bcdefghjikmlnoqprsutvwxzy{}|~      !"#$%&'()*+,  -   ./0 !"12#3$%&'()*+   4NORPQUVWXST~?Avw|qrsYZ[\]uwvyx}llll0 " @ < hTH..>!"H#2#$%&'.')~)+-./p1 2n45D6$7>9$:x;n<==r=>>?$AB CHD8FDGDIJJK~LMNOPQRStVfWXnY[]v^`\aac"cd,d\dde&eveef$fTffg gNgghhHhhii8iijj0jrjk kDktkl lnRoqqrsuwxyy^z>{p|~~lJ^0j."|8:FdNL|*:Xb\&` Db| f6Z&P"2:,`~|2vIJ0bŔ2~.dɢɺ\ʌʼ˸j̞N͜<xδ"RςД"` Bz԰.t$0hݒ @>h(\ (Hh@pLv.dP:nFnh ((hpvxvL(RnN~Br2b"Z    L z       Dr0.^L|>RBrxF(&VHx@p~ f"$n&(8()).)+,h->-.01t11122222233344556 66*6:7 8&8Z88899L9:j;`<@= =>?N@bA&A6BBBRCCDEFGGHH@HpHHIIK KK*K^KnLtM`N.N^NOOOOP<PPRSTU.VXVVVWWTWdWtWX|YzYYZ[ [\h]P^ _4`Zaabcdddfh$hhjjklJlZlllmNm^nnoLophqqrstuvwx<xjyyyyyz{|} }:}~8~~bxx\*n(r2nNd^VJr>|x<HjnT`*`HvTvnZ82fBRHRbZbÌbǼʬ˘`>πѬ:tԒբ Jt\؆ذ.Xق٬ 4^.>hݒݼ߀Xh4 H2\.X*T~dLN.R fHHr  D n     @ j     < f     8 b  $  PZ\>8H!#8$$%l&'T'd(0(@)+-.->.:.J//012>34457J789H:;;<<==>`>p??APA`BBEJEZGjGzHIJ2JBKL MMNOOO.PPQQRnSTUWFXZ4[z]<]L^`aacne g8gHgXghhhiijjkkmm"mmopvqsttvHw~y{V|\|l~@BZ"L\l 4^n~2\.X*T~&Pz"LvHrDn@j<fFpBl>h:d 6jFd$X*n2$f0FPBr,>PbrRª NØ.ĆNŤ&x4ǠLȌ6Ɋɰ0`ʐ:xn̲N͎ʹ6\΂ΰ$πϺRЦ.pѰ&bҞ4dӊӰ&PԐ"ZՄծ4Zք֮Brע0`ؐ$لٸPڰHި$ " 08! v0$""!~0cb"%!!%!4/e /84!!!#/4).c"[O"%ecee%"." !8/.."%%../10404$!.#.#/~~0404".".$.2222+1 1%.. ! ! "04048%8%8%8/!e. /044$!$!.#/~04040404cb/%"cccb%."08.v0$."~b8b4%4 '4%4!4%4!4H18!  .)00 v0$".~!%!+F1C!!)4+//e4'  $ +1T TTTT $11 +1T   ) ,,'X+**'     ,  , *))* ,,**,, ***'/'     + /%%%%%%%%%%%%8/8/$!$!$!$!$!$!$!0404     bbb%8/$!0404040404    !" # $"%#&$'$(%)&*'+(,(-*.+/,0-1-2/30415162738495:5;7<8=9>9?:@<A=B>C>D?E@FAGAHCIDJEKFLFMGNIOJPKQKRLSMTNUNVPWQXRYSZS[T\V]W^W_X`YaZb[c[d]e^f_g_h`iajckdldmenfogphqirjsktlulvmwnxpyqzq{r|s}t~tvwxyyz{}}~   !" # $"%#&$'$(%)&*'+(,(-*.+/,0-1-2/30415162738495:5;7<8=9>9?:@<A=B>C>D?E@FAGAHCIDJEKFLFMGNIOJPKQKRLSMTNUNVPWQXRYSZS[T\V]W^W_X`YaZb[c[d]e^f_g_h`iajckdldmenfogphqirjsktlulvmwnxpyqzq{r|s}t~tvwxyyz{}}~   !" # $"%#&$'$(%)&*'+(,(-*.+/,0-1-2/30415162738495:5;7<8=9>9?:@<A=B>C>D?E@FAGAHCIDJEKFLFMGNIOJPKQKRLSMTNUNVPWQXRYSZS[T\V]W^W_X`YaZb[c[d]e^f_g_h`iajckdldmenfogphqirjsktlulvmwnxpyqzq{r|s}t~tvwxyyz{}}~ɽ2@2@APMMoK-12K 2A  @2@2{042{2PAxen#~ncnbd @2A??)A2Du2u(*2A C2 42 @@ 2@2 / T 2A TTnn@n 2A EkF@ 2@>3@> 2A >&82A&(0( 00Po0/zpwwz2$(22 2@2 2?sOs@t2o*@,2@p 222A     г 2@ҳ 2A_02?d3!!@ 2ò+/2ò%2ò2ò2A%$"t5;5;8P/&&$5tA X7 @7@%@-@0%0-0 % - 7 A7 0@7Atttt`tpttttt?O~z{|}tuwp~ppppzp{p|p}ptpupw`~````z`{`|`}`t`u`wP~PPPPzP{P|P}PtPuPw@~@@@@z@{@|@}@t@u@w0~0000z0{0|0}0t0u0w ~    z { | } t u w~z{|}tuw~z{|}tuwA~z{|}tuw0t@t~z{|}tuw~z{|}tuw~z{|}tuw~z{|}tuw ~    z { | } t u wX)~}|{z7w&u t7A5O5_5o55555555@"OO A _5555/5?5?4O45544@ *****A G 7X@ &>&>7&'>&6&6)@+&6&6&6&6&67&62&6-&6%&6&67&*X@"&>&>&>'&>!&> &>7@  '('0'O'bA ' 4]'.['A UTSRVQ)+'&A *'%)X%$#;"9A '-X@  %V@ -AA XXX%X%.-)X @0t-sJaR]%\YXP%I%G%@ Fy@'9 8X7-%2X%,4*%U7@*[B;#"  @+JKKSBKcKb S# QZ#BKKTB8+KR7+KP[XY8+TXCXYYv??>9FD>9FD>9FD>9FD>9F`D>9F`D++++++++++++++++++++++KSXY2KSXYKS \X ED EDYXpERXpDYYKS \X ED'EDYXB ERX BDYYK%S \X&ED!EDYX &ERX& DYYKS \X ED EDYX%ERX%DYYKS \XX&ED&&EDYX# XERXX# DYYK)S \XED-EDYX ERX DYYK/S \XED%EDYX5ERX5DYYKS \XEDEDYX(ERX(DYY++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++eB+1u~Ee#E`#Ee`#E`vhb ~uEe#E &`bch &aeu#eD~#D 1Ee#E &`bch &ae#eD1#DETX@eD1@1E#aDY?CX;!~ +Y #B #BCX-A-A +Y#B#BCX~;! +Y#B#B++++++++CXK5QK!SZX&&E@aDYY+++++++++++++++++++sssssE@aDEiDEiDssstssststst++++++++++++sssssssssssssssssssssstttttttttttttttttttttuuustuuuu+sK*SK6QZXE@`DYK.SK6QZXE@`D E`DY+EiDtsss+EiD++C\X@ t2owww/12w"%2@t/52@t(*2@t!272%2@-2%-7%-72/t+s++++++++t+stY++C\X22++Y+s+++++++++++++++++++++++++++++st++++++++ss++++++s+s+++t+++sssss+ss+++s++++sts+s++++u++++++++u+++++s++++stu++sss+++@@@?>=<;:987543210/.-,+*)('&%$#"!  ,E#F` &`&#HH-,E#F#a &a&#HH-,E#F` a F`&#HH-,E#F#a ` &a a&#HH-,E#F`@a f`&#HH-,E#F#a@` &a@a&#HH-, <<-, E# D# ZQX# D#Y QX# MD#Y QX# D#Y!!-, EhD ` EFvhE`D-, C#Ce -, C#C -,#p>#pE: -,E#DE#D-, E%EadPQXED!!Y-,Cc#b#B+-, EC`D-,CCe -, i@a ,b`+ d#da\XaY-,E+#Dz-,E+#D-,CXE+#DzEi #D QX+#Dz!zYY-,-,%F`F@aH-,KS \XYXY-, %E#DE#DEe#E %`j #B#hj`a Ry!@E TX#!?#YaDRy@ E TX#!?#YaD-,C#C -,C#C -, C#C -, C#Ce -,C#Ce -,C#Ce -,KRXED!!Y-, %#I@` c RX#%8#%e8c8!!!!!Y-,KdQXEi C`:!!!Y-,%# `#-,%# a#-,%-, ` <<-, a <<-,++**-,CC -,>**-,5-,v6#p 6E PXaY:/-,!! d#d@b-,!QX d#d b@/+Y`-,!QX d#dUb/+Y`-, d#d@b`#!-,&&&&Eh:-,&&&&Ehe:-,KS#KQZX E`D!!Y-,KTX E`D!!Y-,KS#KQZX8!!Y-,KTX8!!Y-,CXY-,CXY-,KTC\ZX8!!Y-,C\X %% d#dadQX%% F`H F`HY !!!!Y-,C\X %% d#dadQX%% F`H F`HY !!!!Y-,KS#KQZX:+!!Y-,KS#KQZX;+!!Y-,KS#KQZC\ZX8!!Y-, KT&KTZ C\ZX8!!Y-,F#F`F# F`ab# #pE` PXaFY`h:-&ii( 1IT$UI+v=7NUUeY ;Ra|<AA* ci"+&Y+H!kk ]CIVnwP{(ai5M >[[[? 2 &1=NVbHSw &(~~.A]kuJb d#%*t 0Pjo&NLz8h "OpN5Bka&Fi+8;Z^hs";DOor~"6q&.1OZ22GS<dp*hYz!'+9FKMW\e"+ASae#+1IZ[nqt~uzLmm/j6Pp*  +S?hn@t5=`n!&B<Vkxks:}7S< Ind^9 |+YUa( ]&l7>z&Bi7-  thGhG\H (2APZd}yo ,\<Gd%2v1x  cB,4A8HXlYCp(7BPZdsx\,cAKU_s Ad*8t,@  ,;DVcWd6PFND$B"`9,N8iT=qAPO5R,99pssFYZ\kCU9us99sVss3sMs&s[sWsWsSsA_U_j=aV9b9s#9YV9YVJ,VVV9&ss*sIsUTsAT99s9~R[s0s 9 s s"<=-CaV9YsIsIsIsIsIsIsWsAsAsAsA9999RRRRRsD3VsTs s;Bsd19?d2d<d<so,zd1%%7XWeUdTsds`sj9YHXsi99rd1/sVVsKKsD99uqVVV9j9999Y9Y9Y9&` 9 VJs0"=SVsVUm[(\\(s9bT9VJs0asUasUTksIsIQVsAVsA9y9YRPVJs0,,""9VVNNNyN0Nk+O)OOOjUU"~~~~~~f0 0 *+kUo@:@7?@%UGs#\\MsIasUasUVsAVsAVsA9bT9bT9bT9999999n9us#9ss99YR9YR*VJs0,9 Vs9sIX9?W9 9 9 Vs9s Z\)0/&?k9)V9V&f9YVZ,VVyVjb9VNN9lsNSN9vss NRv)NvvN9vNvNZ/XVJ95s#7V;, 9YVa,YV} 'W@sI\UsARsUsTs r(k8sEUkQs09@9@sA 011~!}eYA f2/NZ}/,(KA 7/KPY dd  ,(Zc-^^^6P P/,(,(y2ZZZZYYYA f2},(KA 7KPdd ,(Zc-/AKdA%QC~FFFFHFFQF~~P~~~-~~~~~55X~~~F22,,4x000vPvPooVooV(o0FF@FQ s-g.~ ^ALL^`(0,,`22,,6R@22,,22,,4x0004x0004x000vPvPvPvP2222,,}},,00000000T4FTT4FTuupmmpToToiiggRRTT,,XR@LL(o(0,,T"T"T"TFFQFFHFFFFF@0FFYR_1U&ipx\EU_%6pTY~4PF>:&/v9sIsIsIsIsIsIsIsIsIsIsIsIVsAVsAVsAVsAVsAVsAVsAVsA9j9]999YR9YR9YR9YR9YR9YR9YRYRYRYRYRYRVsVsVssI999YR                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           "                                                                                                                                                              "               &                                                                                                                                                                 &            *                                                                                                                                                                   *                                      0                                                                                                                                            0                         6                                                                                      6:                                                                   : @                                    "    !"                   #" !!    $                     """"          @    !B                 ! #  !#!   !             &!!! !!!!!"#        #          $#!" " !%                 !      ####         !B   %J !   $ #     !    % % ! %%#%   '         '%%%$%%%%%&'" !      # %! ###   ""      ! (' !!%% $&   $"%)               ! ! %          !!!!''''          %J         *T #   )! #!!'   %! ! **!#  %*!*(*  + !!!   ###!  !!" /***)*****+,'  ! %!!!   !!'! *%!'!'!'! ####$&#'#  #!""    $ $% .-%&#!$*+%)+$""$$ )&*/      "             % % *       &&&&-- --          *T$###  !!!!!!!$$$$$##### !.\# *!   -!!!$ !% $$! +   (# ! $  ""..$!!& #).$.+.  + $$$   !&&&$ !!!!!   $!!  $$ 0...-!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"...../0*###$! )!!$$$    ! !$$!    +# .)$+#+#+# &&&&'*&+' !! !% $!$%   "& &)! 21(!!!(  % $!!&" ./(-!!/! !(&'"'' -*.3#      &     ######## ########### #####(#(################ ##.#############################       ))))11##11####   ## ### ## ### # ##############################################################################.\'!&!&&  $$$$$$$'!'!'!'!'!  &!&!&!&!&! $     2d&*$ 1#$$$!'$ $)$'!'$! $!/!!,'##$!$'$%%22'$$)&,2##'2/2!4#!#!! '''$$$!$!!***' !$$##$$$!!$$'$$!  $$''"$72221$##############################################$2111135.&&!&'# ,#$$!!!'''$$    $$$''$! $$$$/'!#2,'/'/'/'!****#+-).*#$$!$ $!)$ '$! !!'( !'++!,$! 75,$#$$$!-$$#)$'$!$ +!%#33+1$$4$ # #+'($++0-28&   #") #### #"  &&&&&&&& &&&&&&&&&&& &&&&&,&, &&&&&&&&&&&&&&&& &&2&&&&&&&&&&&&&&&&&&&&&&&&&&&&&#     ----55''55''&&   && &&& && &&& & &&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&2d+$)$**############!!!!!!!!  '''''''+$+$+$+$+$$$)$)$)$)$)$!!!# '$$$$$6l)0'   !5%'''$!*''!-'*$*'$ '$3$#! !!!!/!!!!!+ %%'$'*'!!!!!!!!!!!((66*'',)0!!  6%%*636# !!5%$%$$***'''!$!'!#$! ---*!$''!%%'''$$!!!'!'!*!''$  '!'!!! *)!!%%!;6665' ! !!&"&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&'!65555!!!791))# )*& 0!!%''$$$*!*!*!'!'!'!'!'!*!*!'$ '!'!'!'!3+#%60*!3+3+3+# ----%.1-2-%''$!''$-'#*'$ #$)+#!!!!!!!'+!+$0 &$;9/!"'%''&$/"''!&-'*'$' "-$'&77/5'&8'!!"'!!")!!!!/!--'.!. !41!"6<)!!"!"! %$,%%%%!""! %$ ! )))))))) ))))))))!)))##)))))/)/#)))))))))))))))) ))6)))))))))))))))))))))))))))))&   # ######11!!11!!99**99**))!! ## )) ))) )) ))) ) ))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))6l.&-'--%%%%%%%%%%%%$$$$$$$$*!*!*!*!*!*!*!.&.&.&.&.&'!'!-'-'-'-'-'###%*!'!'!'!'!'!:t, 3*" """#9)***'#-* *#1*-'-*'#*'7'&#"  # # ## 4#### #- "))*'*-* ##########   #++: :-) !)0 -4##" # :))-:7 : & ## <)')''---***#' #*#&'#""000 -#' * * # ) ) ***' ' ###*#*#-#**' ##*#*####-.$#(( #@:::9*"#"##)$)))))))))))))))))))))))))))))))))))))))))))))*#:9999###;=5,,&",. )3##) * * ' ' ' -#-#-#*#*# * #*#*#-#-#*' #*#*#*#*#7-&) :4-#7-7-7-& #0000)15061)**'#**'1*%-*'##&'//&$#"#!# !##$"!*0"#"0'3#)' ?>3#$))**!)'2$**#)1*-*'*#$2'*)8929*)<* $$% *$$%+#### 2 $"00*2$ 2" # 85#$:A,"! $$$#%$ ""!)' / ))))"""! $$%$""!)'!"#  !!!!!!!!!!,,,!!!,,,,, ,,,,,,,,$,,,&&,,,,! ,3,3% ,,,,,,,,,,,,,,,, ,, :,,,,,,,,,,,,,,,,,,,,,,,,,,,,,)  %! &&&&&&! ! ! 44##44##>>-->>--,,$$% %!#,, ,,, ,, ,,, , ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,:t1)0*00) ) ) ) ) ) ) ) ) ) ) ) ' ' ' ' ' ' ' ' -#-#-#-#-#-#-#1)1)1)1)1)*#*#0*0*0*0*0*&&&) -#*#*#*#*#*#C2 %%;0'%%%%%%%%%%''')A-000-)40%0)904-40-(0-A-,)'%%)%)%))%<))))%)%5%""'--0-040%%%%%%%%%%%))))))))))%%%%%)11C%C40%%%%'!07%3<))'%%%)%%C--4C?%C""%!", %))%"@-----444000)-%)"0),"-)''888%4)-%0%0%)%-%-%000-%-%))) 0)0)4)00-%(( 0)0))")"(45)) ..%(HC"C"C""B0'('((/*/////////////////////////////////////////////1(CBBBB(((DG=22$,(""25%/ ;!((-%0%0%-%-%-%4)4)4)0)0)%0%%)0)0)4)4)0-%(0)0)0)0)A5,"-%C<4)A5A5A5,"%(8888-9= 7>8-00-)00-90+40-((,-56,) )')%)$%%)%))#''18')'8-;(0-%IG;)*0-00&0-;*00)/9040-0(*9-1/CC:B00E0%))+%/!))"+2()()%":%)'6819)%9'%)%%A=)""(!CK3''%))*#!!)*)$('!"-%%%"7##!!%1111''''%)*#!!*)('"-'!')    &&&&&&&&&&##222&&&2222222222222)222,,2222'%##3;$3;$+%222222222222222222%C22222222222222222222222222222/+',,,,,,'%##'%##'%##<<))<<))GG44GG44########$$$$33))$$$$+%+'$(!$!$!$22 222 222222 222222222222222222222222222222222222222222222222222222222222222222222222222222C9081"88-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%4)4)4)4)4)4)4)90909090900)0)8181818181,",","-%4)0)0)0)0)0)K8$**@6,**********,,,.I56662.:6*6.?6:2:62.62G22.,**.*.*..*C....*.)<*&&,55626:6***********..........*****.77K)K:5)))*+%5>):C..,)*).**K55:KG*K&&)%&2 *..*&J52522:::666.2*.&6.2&2.,,???*:.2*6*6*.)5*5*6662*2*...$6.6.:.662*..$6.6..&.&-::.-$3!4)-SK&K&K&&I6,-,--5/5555555555555555555555555555555555555555555557-KJJJJ---MOE88(1-&&8;*5$B%--5*6*6*2*2*2*:.:.:.6.6.*6**.6.6.:.:.62*.6.6.6.6.G<2&5*KC:.GF?5662.662?60:62-.22:<2.$.,.)#.)*).)!..',+6>,.,>2B-52*RPB./7566+52B/66.5?6:626./>275LMAI65M6*..0*6%..&07-.-.*"&B*.,>?7@.)@,*.)*ID.&&.%"KT9",+")../'%%./.)-,%&+'63)))&=''%%*6666,,,+").!/'%%/.-,&+'63+%,.# **********''888***8888888888888.888118888+*'' 9B)9B)0*888888888888888888*K888888888888888888888888888885#""0+111111+*''+*''+*'' CC..CC..PP::PP::'''''''')#))#)99..))""))#"""0*0+)-$)$)$)88888 888888888888888888888888888888888888888888888888888888888888888888888888888888888888 K@5>6&??5*5*5*5*5*5*5*5*5*5*5*5*2*2*2*2*2*2*2*2*:.:.:.:.:.:.:.@5@5@5@5@56.6.>6>6>6>6>62&2&2&5*:.6.6.6.6.6.S>'..I< 0..........0003Q9<<<73A<.<3G>,61**>A.;(I)229.<.<.7.7.7.A3A3A3<3<3.<..3<3<3A3A3< 7.4<3<3<3<3OB8-9.SJA3OBOBOB8-.2EEEE'9GK'DMF9<<73<<7G<5A<72487DC83'303/&3-./3/%33+00@H030H7I2;7.[XI34<9<>>///>>>>>>>>>>>>>3>>>66>>>>0.++$$?I-?I-6.>>>>>>>>>>>>>>>>>>.S>>>>>>>>>>>>>>>>>>>>>>>>>>>>>:'%%6066"66660.++0.++0.++$$$$KK33KK33XX@@XX@@++++++++-'--'-??33--%%""--"'%%%6.60-1(-(-(->>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> SG;E<+EE9.9.9.9.9.9.9.9.9.9.9.9.7.7.7.7.7.7.7.7.A3A3A3A3A3A3A3G;G;G;G;G;<3<3E222.K00..3CCCC6665*39(:0-.:#876/50C>5-68!+444444444400EE E444EEEEEEEEEEEEE8EEE<<EEEE5300((FQ!2FQ!2;3EEEEEEEEEEEEEEEEEE3\EEEEEEEEEEEEEEEEEEEEEEEEEEEEEA+**;5<< &<<<<530053005300 ((((SS88SS88bbGGbbGG000000002+2!2+2!FF8822!!**!!&&22 &+***;3;527-2-2-2EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE \NALC/MM?3?3?3?3?3?3?3?3?3?3?3?3=3=3=3=3=3=3=3=3H8H8H8H8H8H8H8NANANANANAB8B8LCLCLCLCLC=1=1=1?3H8B8B8B8B8B8dK /88XH!!':!8888888888"":::=bEHHHC=NH8H=SHNCNHC=HC_CB=!!:8!8=8=8!==8Y===='8!=6P852'':EEHCHNH88888888888==========8(888#8=JJd!!7dNG7778:1GR7%%MY==":787=88dEENd^8d22715B8!!==82gECECCNNNHHH! !!!! !"!=C8=2H=B5C=::!!!SSS8N=C8H8H8=7!E8E8HHHC8C8=='=0H=H=N=H'H'C8=!=0H=H==2=24::LV:=:VCYFEHH9GCX?HH=FSHNHCH=>TCIFbdWbHGgH8>=*?8H2==2@I<=<=805V8=:RSIU=7U:8=*78a[=25=1-doM!!!!!!!!!!!!!-!!!"::.7=)>?412=?'=6;;2394HC7772R44228HHHH::::-7= ,? 412?'=;;394HC:1;= $/88888888885 5KK"K888KKKKKKKKKKKKK=KKKAAKKKK:844++LX$6LX$6@7KKKKKKKKKKKKKKKKKK8dKKKKKKKKKKKKKKKKKKKKKKKKKKKK KF/--@:AA"*AAAA:844:844:844""""++++ZZ==ZZ==jjMMjjMM444444446/6$6/6$LL == 66$$--$$**66"*/---@7@:6<161616KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KKKKKKKKKKKKKKKKKKKKKKKK dUGSH3SSE8E8E8E8E8E8E8E8E8E8E8E8C8C8C8C8C8C8C8C8N=N=N=N=N=N=N=UGUGUGUGUGH=H=SHSHSHSHSHB5B5B5E8N=H=H=H=H=H=B?@ & +<  @4 @$&4?   N!> 0@`N |+]<<<]r++<<<?<<@fv@ 0MC+N]M?M99910rq5!52.kQhF@(  " "@ 0k+]??<<10]#&5673ecVg=5#Q!WfCQ@I@'' gg  " " jC+??<<10]>543ESD:fBKQu/@%UVEF  +&@  @+  >@'4>r @4O_>@@4O_>r @4> > ?  |+N]qM+]+]++?<]999910]]]'6767&'&'7&536767'HNvU;gBZL5ox$=uQJ 5@gI))elUV B@ b0@7bb @bO MC+N]M<</]<<10%!!!!!}}u ?   @8 r&$ 0 gv+N]M?M99910!'667#*uZ7UHzp tbUAi2@!0@7 0D 0l+N]M]/]10!A($@8 & 0gv+N]M?M103!;8@I l+NMNM?32#"$M rQWwrR6KrxXIHf my}g~!hnpj|iWJXd`,[ls&D @9 9  + S k  %( H [     @    @  ( X  @?LH+Nq]M]<<??<]<99999.+}10]]]+!!533#~|춶'^ [5@) 7EI  !# @    0@PV 4 Z@  /  @4 @ 4 0@@//?O@4@@!@ w@ӹG+N]qMN]qM<?<+]q<]++q?+q]q9.+}99910q]%32654&#"'!!632#"$[ vMXzyay`,^biy_ok!/ٵW*#@;j u 6Dz @4 !/!!@4!@  O!@"/@4wO  %$+NMNqM?+q]]+q?+q99]10]]&&#"632#"3232654&#" TCY{i*~QNhpTQpSTP|Yd鉕zW @14  :8 HV !   / / ? O  @4  X/`@O  +N<q#$H%(0A#$Ka;3a K!$ +\A 0HH(k@0a> 0P>b7a Ojl+NMN]M]?<????9999999910]]%3! $$!2!"&'#"&5476327!327654! 32$327676654&#"d  )ϝSTvۄU0Lf~X0gL92&%5MiPVJs:8ro3D:LKo x+=eqy 2@ 794(794@ (54@(54@P!'4(!'4)**( / 87? jjefhg J       @> @ 4 % @ a@  0$@  0  $a@  ^c+N]M]q]qNEeD?<<54&&'&#``-7fMb(|7H_<&εcK*5VŪf @=%0 % % KH   0 @    0 1S+N]#г>#9"9#ɲ9"@9 9 9 9"@ 9 9  9 9+++++++++++++Y10]q]%32654&'&'&'&54663 &&#"# J =L4`}}I/,8uyQ4I.;Vypf qc5"94%/fm~k,r@#/ 00P p % -@  0-@Pp+N]KQX@8Y$@8  GG W V % @"@P`p 0 01u+N] 5     Vg@    0f ^c+]<<??<<<99999.+}ć.+}<10]+!!![YRUiQD @9 *%&@% Hp  @% 4 @ P `  0@P`R +N]#2N@hJHI% 6FW&fg&&  ')Yw 4$21, $@+.4$@"(4$@4o$$$F@04=,3@4U!@?!@?!@4!t ,?,?,4,t@@ 1&) ( Y    @4 O44`03)!_O_o3iA+N]qrMq]N]+]qrM<?+++?@QXYYhii}y 88JJFY i :77ww 443 4 4  t@ @4@43t@ @4!/ @4 !O!XA+NMN]M++?]++?++++10]qq]&&#"3267#"321cOi}kPf+2ST[o/&%Ta@-YY YVVY p:4 :4JD JD t t@  ) &)@!X<+NMNq@F 9  HGF O   @4@4??@ P`43 4")4+-44@4_t t@$ !/!O/_o!@ 4iA+N+MN]]M?C\X@@(?@?@?@?++++Y?C\X(????++++Y]q+++++C\X99 >A!?++++Y+9]C\X@@?@?@?@?++++Y/<++r++<310]q]+# '&532!326&&#"6i@aBZ'xV\<<R/+}HlzCCs@26*  Y  _  t@ t@ 3?OP(/_@ &_ 4xi+N+q=5&PS$9QKITQ`>#/2@`w p1 1 ##033@CCYYY%V)V+Y/; 3;(3,K DK(D,   * '- $43> >(*4#%4144@ 4`_t't -t@ *) &)@ 11@ 3$!0X<+NMNqp`gheF'8!1#^ Gj<Y@+933BB $Xht@   & @ $4   @"$4p&@ $4?<+Nqr+';)@] ?  4444#DEED# /)S `)))  ))))/)P)))))@4?)P))))!t !t@'&' &@Z5`oF@&@Z5o`F%&&')' ?'@6 ?'@Z5'@A5'@<5'@$'4'@:=4/''''''' '0'''(<+N]qr+++++++@Zh44DDt@   &@ $4@"$4p & ) @ $4   ?<+Nqr+ @H YVVY    ut t@9`p!XA+NMNqM??10q]]qCX@ iffi]Y]]4632#"$&%32654&#"R4 nnnn"Äl>@.8H49 94DI ID VV YVVYtt@ !p)&)@ p?A+NqM<<NqM?@7<4 4<JD DJp4YY W VYYV   t t@ !)&)@ X<+NqM<<NM?@( Sfu/Xhp    ? O  w@)  (  0 p  _&)@ ?+Nq*n@#'#'* F !# ") U e " A#@$D&g"d&"$ 7&EF J OF!B""$'&7 5!5"5#5$  ! ' """#$"@,s xyv)u***"# **,"˳(*4!˳(*4"$4!$4"4!@4k 6"F" """!" 43-? >"%4@40@P`P`4@p_F( @43@-?@ >@574@+.4@%)4@4_oU@"$4PF!@!#4@43!P%%%@4%,@ ?P,0,/,,!03! ? ?@ 4+x+N+++MqN]qr++qMqr++?]q+]+++++++?]q+]qr+++++9]q++++++10q]qqqq]]C\X$@ ?( ?! 9  9! 9" 9++++++Yq]%327654'&'$'&54632&&#"#"&0ncm7%I[~(_Xo0 &YX/+RU(/ K>V1>B#fJKҰ@) # ):JY   @`tt@ / //_@(&U?` 0x+N]qrK7SK;QZX8Y FGGHI wxwx x w     -@ :4&:4 @ :4 &:4 @ :4&:4:4@ :4 @:4  M L@2      /?A  m m@  Ĺ+NMNEeD]?<<7654667633"3#".54'&&?c{P+"[m.B4+d7PEQL@ P@P44@Io+N]q7>7&'&'&'.#532IJ5 #^[=5kB,I9J"/ Aq5b#Z\$U@0vš]3zh}W!0.BfFK2*e8PECi@:   )9 6 69 * $$* 0@70 @  7+ @!0@7+0@7    jk+N<]</M]]]]10]]]]6323267#"&'&#"C?j18F.X2_gXoEK0T-C&$z,'@O/ ^H+4)++]q55&$@  H+ )++55a]^&&"@""""`"""$H+*)++]q59&(Rf,@ O CH+4)++]q5# &1V-@@4@4@ 4H+4)+++++q5Y&2,5@/@oH+#4)++]qqr55$&8,)@o!!!O!!TH+!4)++qqr55I.&D@O6 666H+65)++]q5I.&DC@ 4H'45)++I.&D@ 8h+75)++5I.&D'@::/:::YH+:5)++]q55I.&D(@333/333=H+D5)++]]q5I.&D@ 6H'65)++U]?>&F*!_!!4!@ 4! 'H+))++++]5A'&H1@  O   @ 4 (H+ 5)+++]qq5A'&HC@? H+5)++q5A'&H@ " h'!5)++A'&H+@?_ H+5)++]]q55~C&$@4@ 4H+5)++++5&C'@ 4@4H+5)++++5r&$@ o    |h+5)++]q5p& @   H+ 5)++]q55Y&Q(6@p ,H+(5)++]]qqq5R&R-!@P`2H+5)++]q5R&RC!@@ 4 H+5)+++]5R&R @ h'5)++R&R'@!o!!!!YH+!5)++qr55R&R)6@pBH++5)++]]qqqr5S&X'/@oO_P`6H+5)++]]qr5S&XC@H+5)++]q5S&X@ #h'5)++S&XwH'5)++D# F@, /?O8 8 8_ jC+N]qM<</<]&&@n%%9JHK&W WXh&&w789%+$&:: & %   %  33!t3t 3 o@ _/?O!//?O! 0 4( o $$!@ 4'X{+N+M]N+]M]]????.+}99<<<<<<<<10]]]]]3267#"''&532&'&#"Og+23uzt-1q{pC j}L+[o/~"<$x#H2H^V S6@(  733z,,8H &+&%%t@ ('t@ P//t/5 +5t 8@$8&'* *85"  7|+NM]]<<;+7.(yy7S(S>p>p((>(7>"7"4(5(J 7J7j7.(>7"4;+ 1@ \\1"@% 4>8?Oo577B8>(@.5>>(((((Ajk+N]M]]NM]]]+?/9qqq]]]]]999]910]]]]]]&&#"#"&'%32654'&&5467&&546326654&'%OFAD.\8WK[[=<eMBN%&7Z_23ӿ,+.g"4JN9$1-0IW]@8Gƥ!Z[E1/%%#wb66p: (I"!FKJ*e[B  m2 jk+NM/10#"&54632z{{z{zzmiW~@ I IO`I l+NM<<q<<<?<<9910#&&5466763!###{R^8Uqmزif H3@)=Y ]X"#)+#+$'#t -t@ 3 `@%_o(I%%! U*!o@!P55523Y4?A+Nq4)7H8C@y9 966O3O4*& ++v&y3}4h43ggh6Z4g699)49604+1:9E6778BCE"p!!1228   >@ (((((K2@ ?1p1111&@ EC8!  & D^J+NM]<9%*7 m s { S [ c  K @ P  ~@   @@4`@4 4++]<<++<<?<<<<<<99910q]]]]]qq#5!#!!!##Y[34ssC@ 4 $4PY@ an|+NM]?]q10++!;+6@ϰ _ !l++N]MN]M?<<105335312@_        s0@7  ?O7   Jk+NM<<?E > @"EE2*E1gv+N]MNM?9999+]9+]10]]6632#"&'#"&5463232654&#"&#"3276J_^KLRZA3gdZ.CB/'6KykjzTXXʁ-vW^hH~JBDL$23e @# b0@7 b Z0 @  7 @ b b@b  P  hk+q]<<<<<<?<]<<]<999910!!!!!!d}}<) @_ 4@47G77/@ 0@7   @@ pP jk+Nq]<M<<<<<<<<?<]<]10]++]q5 !)CP<) @7G P 4@ 477/@ 0@7@   @ p jk+N]>@ @  O @&@254@-04@)+4@$'4?@l+]q++++<]<]]<<<]<<<??<<<+<+]q+]q+<<]q+99<<<<<<10]]]]]]q+!5!5!5!!67!!!!!!s4&#4 xxwVP=BKxoi5&g@yy  t@! / &   &+N]0;H@k 0##($#955#IEE#W?e?>$  GYiJ(( WWgv( 7I.# #<;+;1@41111@41+*9*@.9`***6.<@+.4<@"'4<@4o<<vVGd%eD;Y#C5WFJA0S1II=UQ~G )MLAD11111zIiX'8@77I@t=>*:R/#iW_%@z*:' V   {   || '( '@FF LLIKK]   !!%$ 3!t 3t@@ 43$!' @ 4 3!&XA+NM+NM+??9999999999<<<<<<<<10]]]]]]]]q7#"''7&&5432&#"32654hplSY+B",)0V8.wtE(&hiE+@h #(+&) )&&) )#)(%+79 9 769 9#6+(+    #''') 0@7+0 @  7 @0@7+0@7@0@7*+0!@!!7"@!0@7%+0@7 "0""-,|+N<]</M]]]]]]]]10]]]]]6323267#"&'&#"6323267#"&'&#"?jH8F.X2_gX?jH8F.X2_gX[EL0U-CZEK0U-Ck@MhLsL !|++N]]9/]?@$ 8  && & @ ͫ+N]M?<<<210!!!!!!<<9&$Cf@  H+ 4)++]5 &${V,@ @4 @ 4 o  8H+4)++q]++5Y &2V$@ /BH+-4)++]q5H&@U97LY#  | ** )")&/'0'@'_(o(  )) }{ '(@A 5!%/O%%!- - KH( V$7@'  /   ''ҹ+N]]M<#+7j@%3)W.g. HE FX # ?@ ? ?@0 ?+&6F')9I/ 2+$@4$$$$@4$`99'!@ 43` 4")4+-44999_!t/t 't5t@"!/$!99!2@2`22 20222n,! 8XA+NM]]qN]M?<?<+++++++]+9/++]<+r+<999]9]3++++10q]]]]#"&'#"546326632!326&&#"32654&#"1eKOlσoKEleoM"E z\B].xZc:) |hhnU,HLJJ7JJJJDgyFl}P8wmkǥo|!0@}@ l+N/M]105!s|0@}l+<</]105!h q@   8@ 8 @#$ r & $ r  & `g+<<<=5&PS$9QKImJ&M@D /?dd sv  *:JY _  t@  _  tt@! &/?O`6 3(@ &_x<+N=5&PS$9QKIFD#@_ 0@8 /?O8  bbb b 8 bbbb0jC+]q<<<<<<<<<?<<<<]<<QssQQsrR%44%%44&]GP@ '7G&4@#   a   5!C++N]M]NM?]10q]5327654&#"7632#"&gVY+!>A@CNZ}Hamv &"2cnOX7K`g@ 4 $4 4 $4PY@ n@4n+NM+?<]q<10++++!3!`&ȍ**Q]A@Y i y   4 N!gD++NM+??10]73327#"&54ĖJE?Ie]w8XPN+~lS8@ r_l+N]qM?WEc"ݯj_ fTDe$ln@ffYViff VV Ytt@ !)&&?A+NM<<NM?_~\x -@4` `    -@* 4-4@-P-- &  @ 4#{@ - {@   $`@m@ `&&@ 4h/ o@ 4.Mk+N+x+NM]]qqr+]]]<<<<]<<<<9/?_~ .# {@H     %  % %  C+N&V"@ 22_2p2228H+:)++]qr5a^9&&f)@ 0` H+4)++]]qq5U?&F@ O H+5)++]q5a^;&&h h+ 4)++5U?&Fh'5)++T$@ f i$ifiiV Z$ZVZZ@4_@ 4"tt @ e& )@   &&!%X<+NMNq<<&D]%AAA4A ضH+3)+++]q5a;&'h@0"@""h+&4)++]5Q (@1ij"e$e(YVY["U%V(ie96:!4%JEJ!D% N@  &t t@  $#)& )@ @ `  1!)X+NM]q<<<<???&H1+4+~H+)+++5;&(Oh$@ ?O h+4)++]q5A'&H@  h'#5)++9&/f@ H' 4)++y>0&O]$@4@ 4H+4)++++5z  @8 8% $r&K 0P  01+]<yx,tA/#@ 4!4! "P `  N0@W@ ?#O## @`t@ t@ $"#/ / /_@&U@7;4?`@ 4$x+N+qr+#t@$Vexx      !tt @ OA%!X$]3/3/99???3?310]3#&'&'#"5432632654&#"9MF5 {؅}d`z\`}&tH]x$<<]4IXN"~@*jhggh! 87I FXW tPtt@ ! A$!X#3/3/]99]???]910]]!!!"&547&''32654&#" UʁnBؕܮp'qqnOW{e#OpN> @!!4& ZWig t@ t @ 4  t@   @ 4 e!!!X 3/+22/39/3?2/q+9?2/]99/q910q]q]+"327#"&547&54632&#"{V;jݳ4隦gbFG8E3@cPQ}k96&mNI>@' Xiffi:JXVV44tt t@ ! @ 4! X+9/]3q???10++]]]]!#"54!232654&#"IN'KbKrnus&酡0<혮0a&J@` p t@! 0&? 0 9/]]]??<10]!!!!01&=Nll@%@<\SV (:4KEX66FFwO"t /t@4 'A&Po&Po!X&2/q]<<2/q]9/3/??[y&ȩ\{,x"?d,j=}!(@ =4+N<</M105!5!pk&*@ H'H'++O@"vUf5E5@T  O  Ppo ON $   I 0  0  NMC+]qr<]q<<]]qq<]q<//]<<<<10]]]]]#4&&#"#376632.#N%!i:Qt1Sb67%K*>je):C_a@p4[ ZPaD3_E23_1 E 1<78893MNNNR\""I\+ 9:a 322DD_ ;aU$4 4]@ N)MNE1 413**@@@ @0@@;;9:`|+N)A(C~GJ%>u;&<=) A9H*?UTq17Ol3!!#&&'566L;K=;Ol#67!5!&&'VcM^g;L<;l%-0le`_vSh;5367#&&w__elɐ/.%L;g^McVOn#67!#&&'56673!&'3^PE}}EP^^PE}}EP-++-,Ug3&'67#&&'5566-,,-+^PE~~DO^^OD~~EPg3&'67#&&'5566!!-,,-+3^PE~~DO^^OD~~EPbjk3!!jded0"8@*%\ `$"`#gv+<<<</<<32#4'&'.#"] G~yۤH  aPPc'WF}c^7^:hE3hCHs^3UV _@;    ?O7 ?O7?O70@  MC+N/]ON?2abu u??e!00!"//"!00!"//$$_dd #/! ! 4&#"326%4&#"3263267'#"'vu/"!00!"//"!00!"/2ba2?NOu u"//"!00!"//"!00_dd_$!FU/;3!!#&&''&&'!5!66776674#"32LfX"4I&P|9bkLpP3BD P BE0$e\$,-U?G5_J`]E2H9 Q>=3TjEjT9F=,-I '!!#!5!"&&546632"3254&&5;4gv~~n;I;yzzyoT&#"&&5432'"3254&&$93NXh v~~TfEK25yzzy:"#"&'!726'#"&54766766!lJ\N1K-TZ!-0IClE`a]c %%__[I;R6S73!!7676654'#"&54632&&5463267632#"&'&'J6Qg=[t^"#"3o|rvt3FG)rmYb(tx=3%X=)?&&'&'&&5463267632bsy.)mnQ=&!>?J4194@ 4g4+N+++M?99107!525h&$/@H+ 0 H++]5+]5#)5@OO\\``@9o$'$$ 4 n {3!{@-' $o**{@%`00$$@$o$$$7`+`  @ o6|+NM]]]9/N]M]]9/??+] -k+N]MqD&?ƯE`v̽~Q,grv ^!3c*)ZQ7qx}PTQ`i *6@A(YY-V/V3Y5ii-f/f3i5 6w;5;/33KEJ/D3   5@ $ & " 4 3 (*4 #%4 144 @ 4`  _t&.t 4t )@ "1)&"<88 4  3+!X7+q?99??99?r+++++9/9/]9?3/]3/3/10]q]q!546673326655#"&&5325!# &5432654&#")xf&J8Ada ~Â`ĀXtqbzxpvZt{_9;^'k5W]Gp}*e6+@  @ 4)++5Y56Kb@  @4)++5@/    %  @)@P`p 0 0]22//33//]qr]22//33//?3/?3/9/]9/3///33//10#535!!5!3#!!!!5'E''E<ĺ<Z@54EDXh@4_@ 4t@  & @ $4   <@"$4p&@ $4?qr+<<<]qr+qr+?hn;6,@ @4)++5o6@ @5)++5^6,i@ @4)++5^6@ @5)++5QX6,@  @4)++5R6@  @5)++5nQ+@Z   4244#%4@4@P`p @- 0n]qr9/]qr]qr+++9/+??3/?10]!327#"&547! 6Q#@ @/+]qr5ht@9HUi w@%4 - -' @  0]<]q9/3????2/3/+10]]!6!2#"'7326&#"!& ZVzY\DTHq6E'mƄLV> @ ' t@$ &@ $4<""@"$4""p""")&@ $4?!qr+]qr+qr+22/3/?/3/3/3/??10]]732654&&#"!!632#"R34"6+WBF|${?'PoPasIW&kήmY62i@  @4)++5R6R@ @5)++5YX62@ # @ 4)++5R6R@ !@5)++5[65@ """&@$/+]5*[7>6U@ @/+]5Je66V@ -0@-4)++506V@ +.@+5)++5, @) % /?Pp0-@  0-@Pp+N]KQX@8YM]<<]NEeD]9/9/??M<9/<<10!5!!5!!!!!:MN:(! 4@`@ tt@  / /_@&U?`@ 4 x+N+qrK7SK;QZX8YM<<<<]3/3/??<<9/]<<]q10+3#327#"&&55#535#535%3#'"'Jb|l%^n3&*V9Ӥ$;68@ ( @4)++5S6X@ % @5)++5$68i@  @4)++5S6X@  @5)++5$X68@ ! @4)++5S6X@  @5)++5Q$#@4#Y YWc"""" " % o 4  @ %@%P%`%p%% %0%%% 0$]]qr9/3/+]?3/?3/?10q]q]327#"&547.!32665!2J)yz\~ !)5@$4IFIFFIYVVYg h  @ 4 `   {@$$f33((f{@--f  `"!*o&!@ 0o**@ `  ˵`00@ 4k7o@ 0`pM6]]+]]q]]]999999?!@ HoBB@8`88˵`HH2 42kO+]]q]]]9999]]qqr+]]9/?D4@ )4f{@ )55fDD.99f${@>>f. )+1`!!3!@ o;;@1`11˶+o''7!`AA+@ 4+kHo`  ˵xG2/]3/999]+]]]q]]9?]]9/]99?)65@ @ 5)++555$b%@" J?__4@F4 GUY   % 0c<]9?3Z @q GV i z       t % %ly    0   ]2/]2/9]?2/?2/=9/]q3/.+}ć.+}10r]q!!!!mv{^<,7X<S;V#u@/- @8   0 @ _    0@_ 0]2/q]<<2/q]??<<9/<<10]!!>5!!&$&5V('s:'djMWxUb@e   g dkh %%- Oo @` ' 4 @ '0]3/+3/3/]3/]33??2/<2/10]]]35!! !!5654#"bvFCxaȭ<z?濹?l6,;@  @4)++55X6<E;@  @ 4)++55N6.L@ $$@$5)++5N60@ ##@ 5)++5lV6@ @5)++5G6@ @5)++5l<6#x@ @5)++555l)k@8!H!W'g g' ))t#t@   )))@ &! A+&?*<3/9/3???9/9310]q]$32#"'6654&#"32654&#6hԷӎsQFc"/SPllD:өn鏰v[SgU҈xw]l^& @  @ 4@!&   & @>   9  @ P  &@P9O_ ]3/]q2/]q9??@47DGt@  &@ $4<@"$4p) & @ $4   ?qr+]qr+qr+????10]]!4&&#"!!632VUBOv#{?lsHZ&jNg@"HHGZZTTllddw t@ o tt@ !A!X<<??9/]q10q]q !"&&#"!326*$]UT^s]UU] W&9@`@ 4 &!$4?+??10+q]3!&g& @ UVeftv=(-9Iki @7:4@/24@(*4   &  &   4 4  & !"4 ? +<+2/+99?<D^ @%   h @ 4 @&4` &   &   @?    9@P &  @ P  9O_ ]3/]q2/]q9??Rvl>n@2 4   8HZVVZiffi tt@ ! A& 4+<??3?10]]+%!463 #"32654&#"]0ՍsqyiA+D  NQ>"r@!7GX\v     tt!t@ ! A$!X#9/33/3/?3/2/?23/10]]&#"#"'732654&'&&54$32:qaDz;:T8?UKhܩ/$͋[i*351.54 v2&@ jjyyt@  & @ $4 @ 4   ?@"$4p& 4@ $4<qr++]qr+qr++?5!!.5v'lUVj'SU&}L_L~~̖vNu&'@ " tt@C" !%!)A! o &   o  !%X(2/q]92/q]3/q3/q?<3?<9/10!32665!32654'!#"'#"54 uP7SU6TqD? 8__`_&ᤌDdgBchDr2].Cm6@  @5)++55v26#@  @5)++55R6R@ @5)++5v26#@  @5)++5Nu6&@ )+ @+5)++56(_,@  @ 4)++55/GX 4@! 4-0- %0- 0-@ '  0  ]]<]9/3?Z@ @4)++5l' N@ %  @  /   %/ 0 ]3/q]2/q]/?(l=F$da4@4%%%'  @ 0 0]<]]3//?9/q]10++!!!2#!%!26654&#!HؙŶL( pSPؑN`Ff]b%8% 4@4c 0]++??10!!!G<Q@17 G g % %  % 0  % /3/3/]3/]3//.5GH-WX- @ '++@,-,,--',0#C# e@ C,D e 9e:"+,@:4040)&0960!+0-'",/F?FFc ! D""::,^E2/2/<<2/3/]99]++/<<<-\Lf-n{6i:~8k< -eM^.?@ap,&@Xh FI 4e@ _o@$4%-?O_-  "'' 4 @(  ']3/+3/39/?2/]3/]?2/+3/]|9/+910]q]%! !"$'%32654&##532654&#"f]xxC*fC"um*Cfi@2YNyNZnzePn' @ F04@!44;O />?4[]4@'ST42@[]4@ST42@ @ P ` p   0 []4@ ST42 0   ]++2/]]qr]++2/?qS; ;@ %   % 0    ]3/]3/?(z<<@}E@hh%   @  0]<??<9/10]]!3267!!#"$5}(|x_6(ZToR)(xFN()p S@ %  @  /   @  / 0   ]q]q]?°ѣnx0*@v !  X ee } yy   9I   \z %`% @!! !0!p!,' 0 ]q]]<]99?<D\)@9g#g%h)HGZU#U%Z)h' 7 887H 't@Pt!t@ $!A+`+p+! @:5 X*2/+q3/3/??]q3/q?]210]]]q]3#"'#"6632#"$!3232654&#" s$k>ň"n^;ޑiqli;utE~NW& @88I  $   @ @$&4   @ !!  A"&@ $4?!]qr+<]3/3??9/]r+910]q!2#!32654&##32654&##ggNnlcumxn~&YX|mBGC9B:KN;U&>t @ 4&@ $4?qr+3/+]??10!!!L&& t  t@  &  t 4 4 @" 4 {@EH4@4?&t 0/]3/3/]3/]q+++++3/]?<H-1G@"&'(*).678*9.-*--4@%4--1,-,,, 4,&+*++*@4&( -*@ 0#@Y +, (((I(s((,-*(+1  F |   3@ 43l+0###++++1&/3/3/]<<2/]3/q+9q]9]q?<<<%1\{r҅$=8)e% #m+RCNF~T+m# 3R<;>&@&W g v @#@$&4@024_/K @  K   @@4#!A( O(   @4 @ 4/+]3/+]]3/+39/?2/]?2/]9/]rq++910]]526654&#"'6632# %32654&#IB;II8X$$[bvuU>O_cPI/2U0Z3Sm/ a|)/S8>G^& v@FI7GQ_@$ &@ $4< & $4 ? +2/]+2/?&NFv,,m"% 3]5;&Dж 4t t@ &<&o  ]2/q???10q+!!!#"'523265TfqCn &,9&B#.Kd& @ 4   4@ 44@ 4 4@ 4 4 4@  @      $4<@@!$4@!$4  $4 ? +3/+]3/++9999?<<R7&Ct@ &@ $4< &@ $4?qr+qr+?SU?>F&Dt@  @ 4  4& 4+++??<10!!!!&CQR&\Tl)5@D  1%,15 g&g(h,h.f4 X Wghh h#0t $t *tt@%)7A3!''&--!!X6]<2/<2/]????<333310]]]qq!6632#"&'!#"5432"32654&"32654&3[K8=NQ6NumQRr|NVlsOOrhOOKJJK>8LL?ɗȈ `&[& Y t@ & t@ 4H & @ $4   ? qr+]+3/]?@W X XWg h hg @+/@4@4 KOt K4t@ ! A&&@ 4i+3/9/?+?]9/++]qr10]!&&#"%!2# %3267!+ lb>oebg#cpm|{@@3'Q3>@4 404@%4hhjjeeXXZZUUtt  t@!! A!&@ $4? rq+<9/]<????9/10]]]++++!36$32#"'#!"32654& kܱ uksullu&Sfcғʋ!&@#'   b r   @4 &    @8      &@ $4< !@ '4Xrq+3/]rq+<93q?<4@4XW WXhf fh @+/@4@4 KOtK4t@ &&A! @ 4 i+3/9/?+?]9/++]qr10]++!327!"43 &&#"!pc#gbeo>bl +€3" +3@@{|0>VLp6@  @5)++55QMs&"@ 4' t "@O@4 t& @&4_    !A$@$ &o#]2/q]9/]qr+<??9/+]q?10]+!2#!!#"'53265!!2654&##v{9] -{FYm0j?+ޞ8JP7:M&@&& t@  @, & o@_!A&?q<9/rq]<<?<?<9/r]<<10]q!!!!!!!2#%!2654&##Fdf[xB&{{@xBEL9Y@%64FD  Xh_  t@1  &@ $4<p&@ $4?qr+<<3/<3/]qrqr+?S=It t_ 4i &@ $4?qr++]??3/103!!qN&&A|#0@}@ 0p/3/]/]105!A~ "&@B !7!IE!  !!!1@2  @ @4#t@&& 2 ##@   $$ 4@ (/(2 4 '+2/]+2/q3/q]q3/9/q]2/?<3/2/+]3/?<99.+]}10]q]!!!!4632#"&%32654&#"!!"A߬Z>>A@;;CD58FRpu__vvbby0& Q  t@ &Oɳ@ 4{ &@ɲ ]q+q]q?<M:RrW%Gikf1G4 A  ?3/?10+q!!6324&#"f!fzW:!|ͫ; 71w@  (JGg{w   ٲ3/q9/???<10]qq632!5!54&#"!7673tFW\x2@1,$BHѧ`h%!A ??10!%CK1Q@     Ե 2/3/?3/?10]q]q!!5!4&#"'632'na:NyʽxUP= x@?  hhff  7GXXVVA  ??10q]]]432#"%32654&#"P.!vvu 6/ b%@-'$ 'FDw 4  @   @  q2/q3/9/22?<<<.+}10]q+]%667!'67!qD Y#u+}*dhC1r@!h  *  ״ A  9/?3/?/]108]q]q327#"&&563 !4&#"lv/GTeBi蟡?NQd%h̓db7!@,9;;JMM v״ ײ ҵ# !!4!"+q3/3/9/3/?3/?2/9/2/910]q]63 !"'732654&#"327#"&&5Kݷ7Ҫ8:u/GTN^3C: {8 h% x@  W d vvw   @ 0A  9/]9?/5B,DD"*I51Lt"izBR 48BpYol3IJ24IJ~^`%5nr/?10!!$%Fv4 @274',44274IKI@P.I  KI  >>#3/3/?]KQXY/]10+++++4764763[,S2\,S.+%P+(#>0+%P+(#Fv/:$4.-/4/@-/4$'% -93 I@ 444"$4 3AG@-J#I  @ % )9504 #"@ %/4 )@4)#5@45-/450# </3/+++9/+93/+9999?9/++++q9/999910r+++'#67654&#"6763267&'&5476324&#"6V.:GW(  ."&E?'+5&G %A"  /)C6$B % #F7B*/ //4&U&FT $&4$&4@ ',44 @274',44274I  K I@P.IKI >>#3/3/?]KQXY/]10++++++++%4764764Z,S4Z,ST/,#Q,(";/-#R+*#FvEG@ ',44274IKI > #3/?]10+++4762\)VE.+%Q-'#Hv)(@$4  '!I 4),4H 44  @ '$@4"$@4$-/4$#@ *&3/+++9999?<+++]999910]+'##6767&'&54632'4&#"6S2J2I5G@!M-*  K& ,$27H83'Be8()7 ]."FT=4274IKI> #3/?]10++%4764Z,ST0,#P+("Fv(4@ "4@4 !&A M!K@4MK    % &&*3/3/9/q?+99/+10++#"&'#"&546773276773276573 #** +  &dK06 $ 922 $ #8K1 2(+/FvQ @ 4 #4@ $*4 $*4 @ 014 -/4 I 44K !@ 4  #73/3/]+?2/++10++++++#"&546324&#"326Q\C66P;6Jb<6MwZWD-# O  @ 4 /?@4 @4 _/3/]9/+9/+/]3/+9/9/10&&'6767" d\R $X%+6j5>G|&>hK"P,@G   0@  O9/]33//9/??9/10]#4&'&&'(>-%Xa|V$)I(k~2n;D%Z4@ 4g@   / 0@  9/3//9//3/9??3/9/9/]]10]++#4&'.'3253Zj% 8_]i`LrN:Z:pd@ mS "g@@4"# /"/@##@ 4# 04 # '&9/33/9//+3/9/99/??3/<9/9/+]9/+910q]+++#"&'#4&'&&'326533273+5$%6;$6WhdmDL87JK66N7NO65JHGz6LL66ON0"K@ 4 4F  @  3/]q9/2/3/?3/+3/+10'6765&'&54632&;"J*E)1%)K69VUI;9!777-( $<6MP:dgs@ww00wxQQ# 4 @* 4Y 4B 4,9ak*# q;F`UTGYBNkoqpkoN&@ 4 4\ 4? 4G@# "4 #4GTFUn`a\ h9,*;?&3onohp@ n0nnnut9/]999++++++/999++++10qq#"''#"'#"&5467'#"&54767&'#"&5463267&'&546327&'&5463267632676324&#"326d,!5JJ vV%4j  ! !$"!.0$VqC!;+!+*",k3=E\4"9S,`HA +n[ZB3)H.6#F ׹ts'!^zx ,ipE5F%1"A8%#@at 4n 404~Y@#4] #1@0%8O/]3/]33//39/2??2/+9/q9/++10+]]467&54676632&&#"32767x&qDW6<%AXGRWa'=4*2@8?Qv!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ Fv98@ 44 @ 274',4@ ',44274+ "4IKI@P.I  KI@ @ 4 P@ .#@4##.27A M2K@.4.M)K >>  # ""-- .6 77;#3/3/9/q3/q3/?+99/+KRX@Y+]KQXY/]10++++++++476476#"&'#"&5476773276773276573[,S2\,S3! #)++   &.+%P+(#>0+%P+(#L06 " 91$$ #8K1 2)-1!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ %,5nr/?10!!,,%!!%!! @ !!%!! @ !!%!! @ tx!)-$4(4'@4#4$4 4x+C--$(#%CO''u#C@)lS A T  n,*4**"&$$"((&@ 4A,3r/ $*4t.+9/3/9/+??<KRX@Y]992/10]++++++!"&'&&54676673!&'&'7''77'7xyO.Rj *58+I;#q>/ZKhTnPfd%j)A,AXK(O\-9[ L &;kYN5JfPe`txtr ε44@4 44C COu C@lA T  n4  &@ 4,3r/+9/3/9/+??KRX@Y]992/10+++++!!&'&'7''77'7r 7PK7hTnPfd%D/@UKJfPe`tr!!!%!! @ !!%!! @ !!%!! @ !!%!! @ 4`8&*%4$@4 4!4@"4+;Tf&!4(C**!% "CO$$u&C  by dYc)'4''#!!@%%,< w 6v+3/2/99]9/3/9/+?2//2/9/q]992/10+]q]+++++ '&47"!23!2763''77'7~w[!u02.P3/2/99]9/9/+]++3/++9/+++?2//2/]?99]9/+]q++2/+++992/+10++]q]++++++#"&54767!27 47#"!23"33''77'7Ⰰ 䌐WC_`ÿ]yz-?%Q<;*8-^X~H]yDVU%f?:K5 )eP#?t  0 G6?WDRtv!4@444Y4C!!COuC@l a A xn 4@ 4@4 4 r#/9/99+++]9/3/9/+?<2/KQXY]992/10+]++++!!&'&#"6632''77'7vyg[W+)7VBzL<*NjP(AJ1FtdPfJPl+o%T2@4 485,"S@ %b$ 11n2@@4%%4+@ "4+@ 4+A;8@2r4$ * 5"/++3/9/3/+?2/?9/]3/2/10]q+]+"'&54673!&'&'&'&'&54767676767"_U9E<'t'%398 Y2A:B4V(Ob:TGaBmD%JB]|*MK*`G/#(,,$X9Je):-(!#2 " E^No%NF@>;4G1W1: 4(6D##$$ Hcsv'&' @S@ ?? @4  b@ 33 +,n7 @ 4 2@333@ "4@ 4A;@,rH?$ @*C5<"/++9/]9/3/+?<<9]?9/q3/+9]3/10q]]+]q+2767654&'&'&5476767676733#"'&'&'!!"'&54673\l7V.6D)#M8A7]Kk`ak{NlYAuc1JBK\KO*Dnv_U9E<'55P#I?Ie):-&*")$%!'* F4o_"4A5W.XSYJB]|*MK*`G%(%@85   b %%n@ @4 '@ "4@ 4;8r'/++3/9/3/+?2/?9/]3/10]q]!!&'&'&'&'&54767676767"('%398 Y2A:B4V(Ob:TGaBmD%/#(,,$X9Je):-(!#2 " E^N%9@7G3W3(6%%&& Hcsv)()  "" @4  b@ 55 -.n @ 4 2@555"@ "4"@ 4"A ;.r; /++9/]9/3/+?<<9]?9/q3/+9]10q]]]q32767654&'&'&5476767676733#"'&'&'!l7V.6D)#M8A7]Kk`ak{NlYAuc1JBK\KO*Dnv%5P#I?Ie):-&*")$%!'* F4o_"4A5W.XSYo%T2>@ 4<< 485,"99\8P3`33`@4Q$S@ %b$ 11n28(@44%@4%%@+@ "4+@ 4+A;8@2r@$ * 5"/++3/9/3/+<?2/?9/]3/2/KQXY]KQXYq10]q+]]+"'&54673!&'&'&'&'&54767676767"567676_U9E<'t'%398 Y2A:B4V(Ob:TGaBmDWםU"Uco%JB]|*MK*`G/#(,,$X9Je):-(!#2 " E^NOJD9":C66*>...  & ''3#3/3/9/q3/q3/?]KQXY]KQXY9+9/+10+++++++++#"&'#"&5476773276773276574764763! #**+   &4Y+T3Z+T}L05 "81$$ !8I1 2)-,.,#R,)"#/-$Q+)#FvX1 4$&4@ ',44274# "4IKI@@ 4P@ .@4&*/A M*K@ &4&M!K > %% &1. //113#3/3/9/q3/q?+99/+KRX@Y+]10++++++476#"&'#"&5476773276773276574Y-R3! #**+  &X..#P*)"K06 " 82$$ #8L1 2),1@v JVH#4-/4<@ "4TNS@),4H@ @ 4 @H.4@444,?(CHA MCK@%?4?M:K, @TQK@4#Q@4Q-/4QK#@ /!4 33/>((> ?!G HH!!X3/3/9/q9/+++9999?+99/+KRX@Y2/++999910+++"'&'#"&'6767&'&54632#"&'#"&547677327677327657'4&#"66#'#9<8L0: G-/   3! #**+   &Q#  1& "!+U)# K06 " 82$$ #8K2 2)-1( Fvr)14/@ ',414,274@ "4@44MK@ "'A M"K@P.*I,,K0I. *>...  & ''3#3/3/9/q3/q?]KQXY9+9/+10+++++#"&'#"&5476773276773276574763 #**+  &3Z,SK/5 " 82# $ !7J1 2),1/-$P+(#!!%!! @ !!%!! @ ///10#!$HbGQ$///105!#QHG !@   /<//<10###!!!HrG !@   ///10!!5!###rHGS@ ////<]10###!H @@  @4   /9=/<<//<+9=/<<<10#'77'$Hb ׶yyx #@    ///103#5!3###HGG)@     ///103#5!#3###HGGG !@   ///<10!!!##HFHS///<10#!$H,l@ /9=///<10##$HSW$'@ /<<//9/9/10##$HHH'88W' @   ///1053#5!#3WGBGGGW'///10#Hnw W$'@ ///10]#'$H'0W'///103!$'wG-?#/@D # # 5 5**G> >@2$$G5>5>!055 >>''G@ 55 >>--G+?]]NM]]10]]'766327'#"&''7&&54632654&#"5m89n42m;8l4wSTvvTTv3m:9m44m99kTvvTTvv #.48DHLRY`h@wz&S%c%#%3%C%Y=i=)=9=I=YAiA)A9AIAV;f;&;6;F;VCfC&C6CFCfhbdV`f`Y[i[**c*****u***3*C*S*cBB(-Wo]?]O]_]]]'VP(/(?(O((/ OGG23/3g<^P''O'_'' '0'@''R F"OM7K R6JMap999@9P9`999'W0^^'''_'o'@f''''$U-e-%-5-E--S++_oZP$$o!6 5## ! #j0eeo??????O??IJN/MMN1EQ2FN/]/]qr]q]]]q3]]]qr]]]/<<<<]]q]/<<<<]]q9/qq910]]q]]qq]]]]]]]]]]]]]]q]]#5#5!!5!#3#"'73253!5!!5353!#32##!!5!#"&54632#3!5!!334##324##32%#"32dCC?ddV4I(_tC~dYwdC~CddCdYeo|~ddd~C-Od?d ĺ[6.C?d{C~ddCcm !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ S0HC@g  q;@ 0%/]q<3/3//3//3/10]&'&'&4767670,h3g9JJ:f5d.l8<"8-}N౞Sy*KgSH:@hq ;%3/<2/2//3//3/10]'6767654'&'7I8h2j,M8"<8l.b6e;KSᮞM-L*vU!!%!! @ .J\.pz @4RbbJXJaJr?rq??Mgff@ nmnnmYXX@ a`aa`MQRR@ ?M??MY@@@ 4$@ 4$',M'K@ $ 4$M K@`fgnmadYX`RQ8U5qr?CFFxC``QmmQr\MMx@QQUn<xdCCC$G.>4, /.  ", - ,QPH AIBJMZ#8%4kx6"!96#~783h"a -CL/ z "DRX )*$WP+6IES 3)A+ QK6"G0439!$2G!Zr?!.3%E-4(_K;D92&:5<.9FK/.g=.BXDl@~^`"@ &7[j`@ @/4 4 a@  4c61@/$   ;/q3]q23/3/]9///q9/+9+9/+10]q'4767&&54632&&#"66`Pc\M2a<"B^888c-a4*;0IF:D4  % A@ 2 `  7H;G+{* 7lc}5CRfr}I, ,$a.EilZi  B$ !W  6082,MX(@44))  ( @ 4W JGг,-4I*+4I@')4C@/;4C@ &4CC-E@)-4EH=|@ 2L54L54-G1{4G22@7B4"""" 4cS,nK5-I"8@')48@ 4882@@@-z@ 22$$$5@rO$ 8:/3/3/2/]9/3/2/q9/++99?2/?+9/]9+3/99+/+9/+++++10q]+]q++#"#"&5476732$54&#"547676633667&&5467632&#"32ۅ-'3Q'%3>8/ZKyxx%j)A,AXK(O\-9[ L &;kYN~rxrr  D@lT  n  4 &@ 4,3r/+9/+9/9/??KRX@Y9/9/10!!&'&'7'7r 7PK7fxx%D/@U(~rr6n)@46F!  4@444C@uC@"'@4@ 4R@ @?O@ 4` 'n@""$ +7@ @ +3@ @*+4@ 4$4/9/++]3/]9q9q9/3/?/]+q++93/]9910++++]r]q+''77#"&5467'6674&'326C@5%2PfJ<{'L:6lZRx.-:'->mx+eC ./@%-<%@4jj 44@444!/.""'((@ ""C@uC@@ 4(-"'!./:d:@ 40:p::::/\@ ?!!!'' -n@'"('@ 4''877<r>/]9/+9993/3/??]9/]2/]q+9/99992/+]99.+}ć<<10+++++]]+''77#"'&'&'#"''&&54767677&&546733'326nPhW$:(6D&7%zN$@&F5#-`%*{ 7!F"0PfJ)MjT#3"+) &sU4"%x  %x@)ٹ44@444  4x C@uC@%S$A T % n 4%&$@ 4$A, 3r+$*4t*+9/+3/??<3/]9910]++++++''77!"&'&&54676673!&'&'7nPhTyO.Rj *58+I;#q>/ZKPfJj)A,AXK(O\-9[ L &;kYN%x@%r44@444C@uC@ @@ 4A T  n0 &@ 4, 3r /+9/]3/??3/+]9910+++++''77!!&'&'7bnPhT 7PK7RPfJmD/@U%r&x! ' 4 4 @444 4xC  C@u C@"S+!A T " n  4  "&!@ 4!A,3 r)$*4t(+9/+3/9/??3/]992/10]++++++'7''77!"&'&&54673!&&'7Sdf|nPhT4289I8*%5X(!# dPfJ *,R^u$VY)aWGGB7@slh&x!%r Ĺ 4 4 @444C  C@u C@ @@ 4A T  n 0  &@ 4,3 r /+9/]3/9/??3/+]992/10+++++'7''77!!&'&'7df|nPhT 7PK7?dPfJmD/@U%r4`8"@"4+;Tf& !!"D@ @ 4 by dYc ""!@P,< w 6v#3/2/99]9/]9/9/?2//2/9/+9/9/10]q]+ '&47"!23!2763'7~w[!u02.P<*NjP(AJ1FtPlPl@ 4D@ Z@ o]@ V   4. $1r 2//3/+9/9/?/]2/3/9/9/10+]'7#"'&'73267654'&'xw^hJXeX*Zn@Ew $48DJz=JR2+><*NjP(AJ1FtPl~x>@ " &"  4@ 4%14,,%;4;4n%n@S V  ~ /,,1(2/'-4/@ 4///7 &,2@$/$$$$$$;;774A4@r@$ +5/2/9/9/]]33/]++99/9//?9/?3//+9/99+10+]]"&'##!"$5476732654&'326546774&54677xn^:[[*.zxNDkG\(%!A 7[$h ?gM~x%$9ƹ@45  6@ 4+.&&646.nn 0@ )&&+!2)'-4)@4)))16611.4r;/2/9/3/]++99/9/9/]2/?<<3//+9/99+9/3/9]10]+"&'##"&'##32765332765476774&547677$pH:[[CN7D:QiF[BF-{z4? &%\32U% #)FQT$;M R23D")p A 7["ls?gM%$~x1 J @ 4 .&. 4 @4444C  C@u C@8@ 41=@881G4G@n 1n@S+A V , %~@  0 ;88=42;'-4;@ 4;;;C,&+,(2@0/000000GG CC@A4@ rL$ +"5/2/9/9/]]33/]++99/9/9/]3/9//?9/?3//+9/99+3/]992/10+]++++]+'7''77"&'##!"$5476732654&'326546774&54677ddf|nPhTn^:[[*.zxNDkG\(%!A 7[$h ?gM~x1%$1 E; 4 @444 44AC  C@u C@2""!!B@ 4)7:22)B4B:n )n "0@ !!!5227-25'-45@4555=BB ==:4 rG/2/9/3/]++99/9/9/]2/9/3/9/?<<3//+9/99+9/3/9]3/]992/10]++++++'7''77"&'##"&'##32765332765476774&547677df|nWhT*pH:[[CN7D:QiF[BF-{z4? &%\32UdPfJ #)FQT$;M R23D")p A 7["ls?gM%$1~,5@ $ 4&2x%%4*4*@ 4?000d((4n@ S V  ~3 -&,2@ /-A7@r7 $ +5/9/]399/?9/?zj=jT!B;O[ &:Uq~%r#-@ 4W*x!4!@ 4@4,?(((d ,n @ +$0@ @ 4 $7r/ /9/+]33//99?<<(?-,O\ -Uq%r}~09@ ( 4 !&!6x))  4.4.@ 4D@ ?444d,,#8n@S V  ~ 7$1#&,2@ #/### 1A7@r;$ +5 /9/]3999/9/9//?9/?zj=jT!B;O[ &:Uq}~%r'1@ 4W.x %4%@ 4@4D@#0?,,,d##0n @ /(0@ @ 4 (7r3 /9/+]33//999/9/9/?<<(?-,O\ -Uq%r%v-6ĵ 4+@ 4 & @ 4   }@ #?111d))5n@&4.@ 46 6  ?#6 .7r8 /9/]93/3/q3/99]9/+99?F~p!92H1+ҏV`Mpz9Q4t0&J  [f|b;5::8>Jc%$"@ x"e@""  R@ _`/ n@" .@ $ 7//3/3/9/99?/]]2/]9/]9]9/]10]##32767&&54632&&#"$piMNZl2"oe]+*O]D|[sS-' K]:IDa$/E%( #@IVw @4@4@ 4# n @.pr% /3/]/999/]/]?<<9/++3/+99910q]q#"&'##3267&'&#"'463233(Ox%AhEQiiSC9  ,}*:0%@GP!;m_3]P4^H5* : @ 4iD@ #4#@ 4 4 #***~&4&&3^Y553n@@ 4 #&**&&5579@4-4 @ 4 /+3/+3/3/9/9/3/999/+]9/9/?2//9/+]99+++3/q9/9/10]+]'7 $54767&&54676632"&'"667!3267Wxyf',a2LV*"On@6,4t#v;7Hzr`9/9/+3e_B6**22F~p!92H1+ҏV`Mpz9Q4t0z5&J  [f|b;5::8>Jc%$f&@ x&D@ e@&&  R@ _  `/ n @@@ 4&$.@ ($7 //3/3/9/992/+]9/9/?/]]2/]9/]9]9/]3/q9/9/10]'7##32767&&54632&&#"xzpiMNZl2"oe]+*O]D|[szS-' K]:IDa$/E%( '@IVwD@ #@4@4@ 4'n @_@4@ 4# .p  r) /3/]/999/]3/++]9/9//]?<<9/++3/+9993/9/9/10q]q'7#"&'##3267&'&#"'463233'xzOx%AhEQiiSC9  ,}*:0z@GP!;m_3]PuV<&/+.@ 4(4.@4(4v  4!4#@4  4( D"R"',4'-.4''*d" en&n@ 4&0 *5@ ?@#49-4-4-(,4--'8r1z2/++++r2/3/+9/9/?2//9/++9/3/9/9/108++++]++++'7#"#"'&546736$3&&547632'&&#"xx8ކT_X,PBHQZݙ")W^qj0+#.%VzKFrOg-2 1/b>6uV<%$@  4(4@4D@l@  0"@""b@@ 4@ 4n@ @ 4 6@ /@ 42r&z/2/+]999/+9/9/?/]+9/+]99/KQXY9/9/10]+++'7!!4'&'#"&547632'&&#"326%xsJX l=PnHOQi)0%/PzYW%9*>BjPv/%6$%<4@4GV244@!#4 !#4*D@P@@(/4o/e@0 n@@ 4 @46@ 446rz+2/++9/9/+9/9/?2/3/]/]]qr+KQXY9/9/10]q++++]q++'7!32&&54632'&&#"|xyK".)nwYe$X,z !mhxV`+Qm,D.9.4 @44%44@444),),C@uC@ @*4@ 4*d@ 2@4227S* 7n#~ @@ !4@4&$ 6/!&5@555@ 4551r;z2/+]q99/]3/9/++3//]?9/3/+++]9910]++++++++''77! $5476732$54&'#"&547632'&&#"326nPhT,S.3<[M<i3n|JPbl?:8'TPfJBx*Vzf  nd|>4Bm,D%(44@444 4(4@4C@uC@  0&@&&b@@ 4 @ 4  n 6@ /###@ 4## 2r* z/2/+]999/3/?/]+9/+]99/]]9910]++++++++''77!!4'&'#"&547632'&&#"326CnPhT)JX l=PnHOQi)0%/ZPfJeW%9*>BjPv/%6$%>!+4 4 @ 4G!V!!4@444244@!#4!#4*C@uC@@!4@ 4@(/4o/e@0 n@ @46@ 446r#z+2/++9/9/]3/?2/3/]/]]qr+3/++]9910]q++++++++]q+++''77!32&&54632'&&#"anPhT3".)nwYe$X,PfJ !mhxV`+Qo%2!D]@ 4%0 4&4322@ DCDDCL 4^@ 4H 42+S*@ 4**823C4??844B}8D2n"3@`p@ 4@4 7@04.4*$ +*.5@''8@488?C3B2/44B  4B4B??DrF$2/33/+/]9999/+/]9/+q33/++/]q9/?2Wa_U9E<'y@7.*%Q #$m @7% TNB{ ++2\.)=6 #9>lz*uU[cn'^$b("VJJ q#i0%&2@ } n@ @4 o/  4r$/2/33/+/]q9999/+?(x^DT23e!/F9,2:p(DgN(r%#t@ 44a@@&/4@!4" "n n 3@ 4`p:r% /2/]+2/?3/93/++10++"'&'##3276767632'4'&#"32i}_:U)GZ5D9YO73KO+0#'4Q &)$1W ERIT6z0W~%xwD@ T  n 4 & @ 4 ,3r/+3/+9/9/??3/9/9/10'7!!&'&'7xxy 7PK7fzCD/@U%xXn&!@%6F  @4 @ 4 R@ @?O@ 4` n@  +  7@ @ #3@ @*+4@ 44 /9/++]3/]9q9q?/]+q++910]r]q#"&5467'6674&'326nnfZN\/=$:b@:R>C@5%2<{'L:6lZRx.-:'->mx+eC ./@%%4@jj4'& @ %&'2 d2@ 402p2222'\? %n@ @ 48//<r6/]9/+999??9/]2/]q+9/9999.+}ć<<10+]]#"'&'&'#"''&&54767677&&546733'326$:(6D&7%zN$@&F5#-`%*{ 7!F"0%MjT#3"+) &sU4"%x  v,6@).I.i.y.6F3@ 43);#K##  4#05 55fn @ @!430405 -'5@  -4o8 /3/]9/]9/+99/3/+39/?3/]/]9+]9910+]q#"'&'##326754767'667%4&#"6764&'32v#0*apyC^JMZZE"&J0 }sv-\ !W?7IWj(.L; $yZe.$Q\Ui39!(* {;02:H2z)2;1س&41س41@ 4jz66س 4/@&4 '868/::4:d77f@P----000%))n%!03$44*7474*8!!38r=/9/3/9/+9/++99?<<22/]3/]33//+]10]q++]+++#"#"5#3276776326633%4&#"664'&'320/$$" *H8Z68?oUK?3% .2dIx3h&E1sW*@MX%)',@}Y% -udVTtRZ* Lqy(982<XLn$ 4@4 &X h yz @ 4 4@4?Z@  @ 4 _?Od.P6!!5r&2/2//]/]/+2/?]3/]310+++]q]++#"&'732767#"&547632&#"3܎S*lE9Ha_px*cuEK`PpxV%OAjj:H6@oښ71$/Ln?@0 4&7:G:W9+@ (454"R!!=3_@@$(4/_o'@ 4b= @ '@ 4'@ 4'` 57704@ @A!$ ""%3/3/3/33//3//++?2/+9/q+9/10++]]+&&#"32272# 476732676767654&#"'&54676632$%#6&9m$(2_wo#'~.JJPJ0>c-a4*;0IF:D 7H;G+{* 7lc}5CRfr}I, ,$a.EilZB1@ 4&  U  !!" 4.@ 4&4&&cS1n@ )))#5r3@$ +5/3/2/]9/?2//9/+9]10++]]+#"#"&547673276654&#"&546767633%-b!el&.8^Fvhp,j>'BZeP% &(7>0>B,2t*\\j'#c 6x P8?r?GL@0 4&7:G:W9+@(454BFAEDDCE@@G@A4AAE@C@ 40CCC"R!!=3_@@$(4/_o'@ 4b= @ '@ 4'@ 4'`@@ 4AA@CCBDGG@FEEDDDFF@@@BB 57704@ @I!$ ""%3/3/3/33//3/9/]3/]=9/9/9/9//+q++?2/+9/q+9//]+3/+=9/9/9910++]]+&&#"32272# 476732676767654&#"'&54676632''77$%#6&9m$(2_wo#'~.JJPJ0>c-a4*;0IF:DJJLJ 7H;G+{* 7lc}5CRfr}I, ,$a.EilZوNRN0N,4(@44))  ( @ 4W /3.1120--4?..2?0@7B4"""" 4cS,n@..-00/144-32231//-@333$$$5@r6$ 8/3/3/2/]9/9/]3/9/9/9/9/?2/?+9/]9+?3/9/9/9910]+]q++#"#"&5476732$54&#"547676633''77ۅ-'3Q'%3> ,/4>.= A&& @ 288@ AAO nZ@"4O4ZODPPDA=>.   #42259.@*88555`p\&&##O######4#(/+]qr33//]3/q33//]3/9/9/9/]9/3/99++?3/]9/3/?3/9/99?]3/]99+3/++10]+++++]q+'#667&'&'#"'.546326765&&5467'66#"&'&&#"'63232674H8>7 reWFr4*BB;@! 'wfP?3.b- $*~0,/;LA,R<"A.',.<$?)H ,.LFGOvrc.%6 (4GW;0?!)%:{6*p``EE=UPo!<|D@pJ1)*1( M  7N>@E4FUgJH4H@ #4>$(4>444N4NKC@4CFHAKH@;; 0 o "Z 7nN@4C4NC8DD8 +!@"4@!`!!!!0!P!!!!4+002..+7224444rP(3/+3/2/9/9//]q+3/9/]9//3/99++?23/?]3//3/9/3/++10++++++]q]+&&'#"'&'&&5432#"'&5!'56676767654&'4733#"&'&&#"'6323267<;aPV&&;gΏ?8,R<"A.',.<$?)H ,.3)3+'9=8'/HaWgnb_@1g/S[k]WDЫæC1( M "<Cdb@()4C)-C"*4^()4^*-4^@'5Z@/;4Z@ &4ZZD\@)-4\HT|@ IcL&4cLKDGH{KG@(I@(4I@ 4II&> *04>.= A&&& @ 288@ AAO ncLDa"O@')4O@ 4OOIWWDzII#A@*,4A=>.   #42259.@88555pf&&?#O##:/q33//]3/q33//]3/9/9/9/]9+3/2/9/++99?3/]9/3/?3/9/99?]3/]99+3/++99+/+9/++++10]++]q+'#667&'&'#"'.546326765&&5467'66667&&5467632&#"32H8>7 reWFr4*BB;@! 'wfP?3.b- $*~0,/;LA  % A@ 2 ` LFGOvrc.%6 (4GW;0?!)%:{6*p``EE=UPo!<|D@pJ1)*  B$ !W  67XS@FUgVJ44RR*-4S@'(4N@/;4N@ &4NNPW@&4W@?8G<{?G=P@)-4PHH|@=@&4=@ 4==  0 o "Z 7nW@8T"C@')4C@ 4CC=KK8z@== +!4+002..+7224444rZ:3/+3/2/9/9//3/9/]9/2/2/9/++99?23/?]3//3/]9/3/+++99+/9/++++10r++]qr]&&'#"'&'&&5432#"'&5!'56676767654&'4733667&&5467632&#"32;aPV&&;gΏ?8  % A@ 2 ` 3)3+'9=8'/HaWgnb_@1g/S[k]WDЫæ.  B$ !W  6" <Cd@ C)-C"*4_)-4_@'(4Z@/;4Z@ &4ZZ\cL&4cLKDGH{KGI|\@)-4\H@TQ@> *04>.= A&& @ 288@ AAO ncLD`"O@')4O@ 4OOIWWWDz@ I@4IIIA@*,4A=>.   #42259.@88555pf&&?#O##:/q33//]3/q33//]3/9/9/9/]9+3/]+2/q9/++99?3/]9/3/?3/9/99?]3/]99+KQXY+99+/9/++++10]+]q'#667&'&'#"'.546326765&&5467'66667&&5467632&#"32H8>7 reWFr4*BB;@! 'wfP?3.b- $*~0,/;LA  % A@ 2 ` LFGOvrc.%6 (4GW;0?!)%:{6*p``EE=UPo!<|D@pJ1)*  B$ !W  6  7X9@FUgJ44R)-4R@'(4N@/;4N@ &4NNPW@&4W@?8G<{?G=|P@)-4PH@HH  0 o "Z 7nW@8T"C@')4C@ 4CC=KK8z@==! +!4+002..+7224444rZ:3/+3/2/9/9//3/9/]9/3/2/9/++99?23/?]3//3/9/3/+99+/9/++++10++]q]&&'#"'&'&&5432#"'&5!'56676767654&'4733667&&5467632&#"32;aPV&&;gΏ?8  % A@ 2 ` 3)3+'9=8'/HaWgnb_@1g/S[k]WDЫæX  B$ !W  6"<C@ C)-C@"*4> *04>.= A&& @ 288@ AAO nA@*,4A=>.   #42259.@88555pE&&?#O## /q33//]3/q33//]3/9/9/9/]9+?3/]9/3/?3/9/99?]3/]99+10]+]q'#667&'&'#"'.546326765&&5467'66H8>7 reWFr4*BB;@! 'wfP?3.b- $*~0,/;LALFGOvrc.%6 (4GW;0?!)%:{6*p``EE=UPo!<|D@pJ1)* 7@FUgJ4@4 0 o "Z 7n@ +!4+002..+7224444r93/+3/2/9/9//3/9/]9/?23/?]3//3/9/10++]q]&&'#"'&'&&5432#"'&5!'56676767654&'4733;aPV&&;gΏ?83)3+'9=8'/HaWgnb_@1g/S[k]WDЫæ!!%!! @ !!%!! @ FvEFv!!%!! @ !!%!! @ !!%!! @ FvQFv!!%!! @ !!%!! @ Hv)Fv!!%!! @ !!%!! @ !!%!! @ FvXIFvFvrKFmH@vJ0vG!!%!! @ FTFT!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ GAQk/ /2/9/?KQXY/?108#4'&'&54632#"&54632+9 %F79IH42HH42HCv~:~-=]\72HH23JJ"  F/?10#"&54632O76LM58N6ON76ONW )A F F /3/?/10#"&54632#"&54632N85LJ78NO75LK68N8NN87NN6ON76ON!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ %F5nr/?10!!FF%%F5nr/?10!!FF%%E5nr/?10!!EE%Y)@A&e$f%wxwu FF  $! @/&?&&&)8 -"- '&&6&&@?5 00@@@2 4(@4(r/)?))@4)& 0p+'0*]q3/]+]+9/+]qr+33]???2/]10]]q]327654'&#"!! 76! 67#smlqnjkp0+rV̸ADu/u򈀀|~|m >Cl\pѾz5R>,@;4'#'""#'hgg hg'XWW XW(@ /))),8 t%t !)@N 4P`+@4+r,,,@4,@ 4,&0`/_.! `  >?4 X-+r3/q]++q+9/rq]+3???2/]10q]]]]+327654'&#"!#"'&&547663267#rKGrrFKKFrrGK%+:Ct|EHYTTYXTTYz|7A%~BF5'޳44 @5R ZTg  % @""@ 4""'8  !@-4!!!p!!P!!!'&@4&r/'?''@4'&@ 4)  0 P(rq]3/+]+]+9/rq]+<?<<2/+]?10]q+++]!! '&'&5!32765!6767#+9\A?( ) (9"|7XrkMMU}6DzK+N.[&%׹4@4   4/ I L@o  %8 t@ &P@454@K5@" 4%@ 4%@4%%%&$@4$r@ 4'&` $4?&+qr3/+r+q++9/+++rq<9/???<<2/]10]r+]++!!5#"'&5!32665!6767#+:Y}P& -)?Gs*8"&|7VVU@0 NvL.[93@^@;B4@574@*34@"4_o@ 4@4@4@;B4@4@4@./4_a@@./4@4@ 4n4/++++q]q+++/++++]qr/++++]qr10#%!DZ;r3@^@;B4@574@*34@"4_o@ 4@4@4@;B4@4@4@./4_a@@./4@4@ 4n4/++++q]q+++/++++]qr/++++]qr10#%!r;_ $#T$4@ 4_Y@ 4a@ n/]]]?]q]q10++#!$; 13@G@;B4@574@*34@"4_o@ 4@4@4@;B444@ ./4Pa./44@  4n@4/++++q]q+++/++++]qr/++++]qr107!1y;a3@G@;B4@574@*34@"4_o@ 4@4@4@;B444@ ./4Pa./44@  4n@4/++++q]q+++/++++]qr/++++]qr107!y;U #R@ 4 $4_Y@ 4a@n 0/]]]?]q]q10++!U; &?w@@& 4@P / ? O  -/4@ 4 p 4/+]3/2/++|/]q}]qr+107676'&#"'6#55*[? 'i{NVpd !f'*Kh2n?@g@ "4/@AB4@;>4@574@*34@"4 >   @AB4 @;>4 @094 @"4 @4 @ 4 "4@  4 /3/2/++/++++++]r2//+++++]qr9/+107676'&#"'6#51'T: $b]  AED ,?w@@& 4@P / ? O  -/4@ 4 p 4/+]3/2/++|/]q}]qr+107676'&#"'6#55*[? 'i{NVpd !f'*Kh2ni?@g@ "4/@AB4@;>4@574@*34@"4 >   @AB4 @;>4 @094 @"4 @4 @ 4 "4@  4 /3/2/++/++++++]r2//+++++]qr9/+107676'&#"'6#51'T: $b]  AED ,I30e 4 4 @ nn 4@ E   E4 4/++]2/]?3/3/]2/108++&6323273#"'&#"q[>k;#= ?gCNIf~6W8$_~:@IYx &)4 !/4s@7 @L5@AB4@;>4@574034@*/4@#4 @!/4s@8@9>4@/34@4@ 44    /2/]+q/++++]+3//+++++++]q3/+108+]qq&6323273#"'&#"q[>kM#= p?gX@ Ce,F,Lp R 4 @ nn 4@ E   EO/q2/]?]q3/3/]2/108+&6323273#"'&#"qq[>k;#= ?gCN f~6W8$_n @4'' '' @= ?O@P5@E5@@B4@674@.34@4@4@4@ 4@n*/4@5@W5@S5@OP4@L5@HI4@DE4@@B4@<>4@5:4@.34@!"4/O_ @")4 Z @")4Z/rq+2/+/]qr+++++++++++++/+++++++++]qr1088qr+&'3327673#"'&a*@AC@$aIMp#v: 8$&3n@4?/O@P5@E5@@B4@;>4@674@.34@4@4@4@ 4@5@W5@S5@OP4@L5@HI4@DE4@@B4@<>4@5:4@.34@!"4/O_& ))&@$74@&4 @$74@@&4 /++++3]q3]q/]qr++++++++++++/++++++++++]qr9+10#73#nڲ6JoH/?80C4@(4P 0&4/+qr]/rq++]10!ox&*@dkk"d%#  @ @ 4'@ ((( #?@! 4! )) ,''/3/3/<<33//9/9/9?3/+]3/]9/3/]9/+<<9910]#53533##5#"'&547632327654#"5!NNZV\YT}[!/VG,/I,/7IIm~glgbgw5M:>n7<\ 6'@W g h W(W1G(G1w . 4 @%(4 `   {@4"&o!!!.:54&{@34 0 /!")@ "4/?`@0o**$`0@ 40k8o@ 0`pM7]]+]]]]qqr+9/9999?;S%!.1cFJ},Hp@"24145WghWW'GG'w$ 4@%(4`H/{@$><<;@ 4;9>*o$ :5 *{*  H@ 4H4@HPHH/`77BBO.o..m@k;#= ?gCNIf~6W8$_I0e 4 4 @ nn 4@ E   E4 4/++]2/]?3/3/]2/108++&6323273#"'&#"q[>k;#= ?gCNIf~6W8$_6I0e 4 4 @ nn 4@ E   E4 4/++]2/]?3/3/]2/108++&6323273#"'&#"7q[>k;#= ?gCNIf~6W8$_p$} 45)++]10; 45)++]10O 45)++]10o}.Tom}o}#o}o}U u#T$4@ 4_Y@ 4a@ n/]]]?]q]q10++#!; Y #R@ 4 $4_Y@ 4a@n 0/]]]?]q]q10++!Y; ~2 45)++]10o}4oM}Poi}Fo_}o}1>oW}o}b:oS}o}I&o?}:@IYx &)4 !/4s@7 @L5@AB4@;>4@574034@*/4@#4 @!/4s@8@9>4@/34@4@ 44    /2/]+q/++++]+3//+++++++]q3/+108+]qq&6323273#"'&#"q[>kM#= p?gX@ Ce,F,L/I0e 4 4 @ nn 4@ E   E4 4/++]2/]?3/3/]2/108++&6323273#"'&#"0q[>k;#= ?gCNIf~6W8$_<:@IYx &)4 !/4s@7 @L5@AB4@;>4@574034@*/4@#4 @!/4s@8@9>4@/34@4@ 44    /2/]+q/++++]+3//+++++++]q3/+108+]qq&6323273#"'&#"q[>kM#= p?gX@ Ce,F,LvI0e 4 4 @ nn 4@ E   E4 4/++]2/]?3/3/]2/108++&6323273#"'&#"wq[>k;#= ?gCNIf~6W8$_&>@4` &4 4/++q??10]q+3!&o&$}  @+5Io.>&D} 45)2@+5?&$t@ `@+r5I.&DJ@0G@GGGF@+]53&$'|q)'@ 4P` H+ @+5+]r+5I.#&D'^9@;;@!4;8H+8h+7@ 477_7777/]q+5+5++]53&$'|n@ H+ @+5+]5I.#&D'M6@(= =0=P==8H+8h+7@ 477_7777/]q+5+5+]5?&$'|u.%@#74%$@ @+5++5I.?&D'tO-@ NM45@8h+7@ 477_7777/]q+5+5+5:&$'|y@@ @+5+5I.&D'z~3@%:O::D45@8h+7@ 477_7777/]q+5+5+]5on&$'|}@@ @ 4)++5+5Io.&D'}@;<)2@8h+75)++5+53&$'{q0@' _  0  H+ @+5+]q5I.#&D'^P@$pBBBB`BBB>H+p;;0;;;;o@H+7@ 477_7777/]q+5+]qq5+]r53&$'{n(@_"o""o"""""H+ @+5+]qr5I.#&D'MJ@DDDDD>H+p;;0;;;;o@H+7@ 477_7777/]q+5+]qq5+]5?&$'{u.2@#7421 @ @+5++5I.?&D'tOI@UUUUT;3@p;;0;;;;o@H+7@ 477_7777/]q+5+]qq5+]5:&$'{y@) @ @+5+qr5I.&D'z~E@AAK;3@p;;0;;;;o@H+7@ 477_7777/]q+5+]qq5+q5on&$'{}@ !@ @4)++5+5Io.&D'}1@BC)2@p;;0;;;;oH+75)++]qq5+5o&(}   @+5Ao'>&H} @+5?&(t@   @+]5A'&H@@01@11110 @+]5 &(hV@  @ 4)++5A'&H@ +@5)++53&('|q)+@ 4P` H+ @+]5+]r+5A'#&H'T9@%%@"4%"H+" h'!@ 4!!_!!!!/]q+5+++]53&('|n@ H+ @+]5+]5A'#&H'C6@)' '0'P''"H+" h'!@ 4!!_!!!!/]q+5++]5?&('|u.&&@"74 &&%@ @+]5+]+5A'?&H'tE3@&?8887@" h'!@ 4!!_!!!!/]q+5++q5:&('|y!@0@@ @+]5+]5A'&H'z~3@&$O$$.@" h'!@ 4!!_!!!!/]q+5++]5on&('|}#@ @ @4)++]5+5Ao'&H'} @%&@" h'!5)+++5j?&,tD @+5]&8@ 4@+]+5o&,} @+5o&L}  @+5Yo&2}  @+5Ro>&R}>  @+5Y?&2t5@0000/@+]5R&R@ ..-@+]5Y3&2'|qr'$@ 4P$`$$$H+! @+5+]r+5R#&R' 9@""@"4"H+h' @ 4 _  /]q+5+++]5Y3&2'|nY@&&H+! @+5+]5R#&R' 6@)$ $0$P$$H+h' @ 4 _  /]q+5++]5Y?&2'|ut6@"7465 @! @+5++5R?&R' t1@$554@h' @ 4 _  /]q+5++]5Y:&2'|y@#- @! @+5+5R&R' z-@!!+@h' @ 4 _  /]q+5++5Yon&2'|}@$% @! @4)++5+5Ro&R' }>@"# @h'5)+++5Y9&jf@----"H+*4)++]q5R&k-!@0P0`000%2H+-5)++]q5Y9&jCf!@++/+++" H++4)++]q5R&kC!@...@ 4.% H+.5)+++]5Y?&jt5@>>>>=""@+]5R&k@ AA@%%@+]5Y &jV$@ */****"BH++4)++]q5R&k)@ .;%%@.5)++5Yo&j} +,@+5Ro>&k}> ./@+5o$&8}  @+5oS&&X}*  @+5$?&8t@ $$* @+]5S&X@ ++* @+]59&lkf%@+0+@+p++++H+(4)++]q5&m'1@!o))O)_)))) )P)`))6H+&5)++]]qr59&lCf,@))?)O)))@4)H+)4)+++]q5&mC@'''H+'5)++]q5?&lt@ 118 @+]5&m@ ::9@+]5 &lV@ )6!@)4)++5&m@ '4@'5)++5o&l} )*@+5o&&m}* '(@+5oX&<}}@   @+q5QR&&\}t@ @+q5X?&<t@ 0@+]q5QR&\L(@ C5(('@+r+5X &<|V@  @ 4)++5QR&\@ "@5)++5<6$i@  @4)++5I.6D@ 37@95)++5o<6,i@ @ 4)++5o6@ @ 5)++5Y<62i@  @"4)++5R6R@ @ 5)++5$<68i@  @ 4)++5S6X@  @5)++5$368 @ # @#/555+555S4&X'=@P"@w@ H'  45)+/+]q5++]5$468 @ # @#/555+555S4&X''aA@ @w@H'@44_@ 45)+/+]++5++5$468@ & @&/555+555S4&X'a>@ %$@w@H'%@4%@4_%%@ 4%5)+/+]++5++5$468@ # @#/555+555S4&X'CaB@0@w@H'@44_@ 45)+/+]++5++]53 t@R @LM4@034@"$4 @4@Ls4@=E4@.34@$,4@4@4@4@ 4/+]++++++++]<]+++</10!5!#53#53~z4 @/ 4@ 4@ 4@ 4 @LM4@034@"$4 @8 4@4@Ks4@=E4@.:4@$%4@4@4@4@ 4/+]++++r+++++<]+++</++++9910#7#53#53疇쌌~4 4 ܵ @4@ 4 @4 @#%4@ 4@4?@ 4 4 @ 4 @LM4@034@"$4 @9 4@4@Os4@=E4@.:4@$%4@4@4@4@ 4/+]++++r++++<+9<]+++</+++]+++++99+q910#537#'37#53ڜQǑؘıbb4 @ @ 4 @( 4@ 4@ 4 @LM4@034@"$4 @8 4@4@Ks4@=E4@.:4@$%4@4@4@4@ 4/+]++++r+++++<]+++</++++9910#53'#'3#53`ؘ'  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ .nullnonmarkingreturnmu1pi1OhmEurodmacron overscoremiddotAbreveabreveAogonekaogonekDcarondcaronDslashEogonekeogonekEcaronecaronLacutelacuteLcaronlcaronLdotldotNacutenacuteNcaronncaron Odblacute odblacuteRacuteracuteRcaronrcaronSacutesacuteTcedillatcedillaTcarontcaronUringuring Udblacute udblacuteZacutezacuteZdotzdotGammaThetaPhialphadeltaepsilonsigmatauphi underscoredbl exclamdbl nsuperiorpeseta arrowleftarrowup arrowright arrowdown arrowboth arrowupdn arrowupdnbse orthogonal intersection equivalencehouse revlogicalnot integraltp integralbtSF100000SF110000SF010000SF030000SF020000SF040000SF080000SF090000SF060000SF070000SF050000SF430000SF240000SF510000SF520000SF390000SF220000SF210000SF250000SF500000SF490000SF380000SF280000SF270000SF260000SF360000SF370000SF420000SF190000SF200000SF230000SF470000SF480000SF410000SF450000SF460000SF400000SF540000SF530000SF440000upblockdnblockblocklfblockrtblockltshadeshadedkshade filledbox filledrecttriaguptriagrttriagdntriaglfcircle invbullet invcircle smileface invsmilefacesunfemalemalespadeclubheartdiamond musicalnotemusicalnotedblIJij napostropheminutesecond afii61248 afii61289H22073H18543H18551H18533 openbulletAmacronamacron Ccircumflex ccircumflexCdotcdotEmacronemacronEbreveebreveEdotedot Gcircumflex gcircumflexGdotgdotGcedillagcedilla Hcircumflex hcircumflexHbarhbarItildeitildeImacronimacronIbreveibreveIogonekiogonek Jcircumflex jcircumflexKcedillakcedilla kgreenlandicLcedillalcedillaNcedillancedillaEngengOmacronomacronObreveobreveRcedillarcedilla Scircumflex scircumflexTbartbarUtildeutildeUmacronumacronUbreveubreveUogonekuogonek Wcircumflex wcircumflex Ycircumflex ycircumflexlongs Aringacute aringacuteAEacuteaeacute Oslashacute oslashacute anoteleiaWgravewgraveWacutewacute Wdieresis wdieresisYgraveygrave quotereversed radicalex afii08941 estimated oneeighth threeeighths fiveeighths seveneighths commaaccentundercommaaccenttonos dieresistonos Alphatonos EpsilontonosEtatonos Iotatonos Omicrontonos Upsilontonos OmegatonosiotadieresistonosAlphaBetaDeltaEpsilonZetaEtaIotaKappaLambdaMuNuXiOmicronPiRhoSigmaTauUpsilonChiPsi IotadieresisUpsilondieresis alphatonos epsilontonosetatonos iotatonosupsilondieresistonosbetagammazetaetathetaiotakappalambdanuxiomicronrhosigma1upsilonchipsiomega iotadieresisupsilondieresis omicrontonos upsilontonos omegatonos afii10023 afii10051 afii10052 afii10053 afii10054 afii10055 afii10056 afii10057 afii10058 afii10059 afii10060 afii10061 afii10062 afii10145 afii10017 afii10018 afii10019 afii10020 afii10021 afii10022 afii10024 afii10025 afii10026 afii10027 afii10028 afii10029 afii10030 afii10031 afii10032 afii10033 afii10034 afii10035 afii10036 afii10037 afii10038 afii10039 afii10040 afii10041 afii10042 afii10043 afii10044 afii10045 afii10046 afii10047 afii10048 afii10049 afii10065 afii10066 afii10067 afii10068 afii10069 afii10070 afii10072 afii10073 afii10074 afii10075 afii10076 afii10077 afii10078 afii10079 afii10080 afii10081 afii10082 afii10083 afii10084 afii10085 afii10086 afii10087 afii10088 afii10089 afii10090 afii10091 afii10092 afii10093 afii10094 afii10095 afii10096 afii10097 afii10071 afii10099 afii10100 afii10101 afii10102 afii10103 afii10104 afii10105 afii10106 afii10107 afii10108 afii10109 afii10110 afii10193 afii10050 afii10098 afii00208 afii61352sheva hatafsegol hatafpatah hatafqamatshiriqtseresegolpatahqamatsholamqubutsdageshmetegmaqafrafepaseqshindotsindotsofpasuqalefbetgimeldalethevavzayinhettetyodfinalkafkaflamedfinalmemmemfinalnunnunsamekhayinfinalpepe finaltsaditsadiqofreshshintav doublevavvavyod doubleyodgeresh gershayim newsheqelsign vavshindot finalkafshevafinalkafqamats lamedholamlamedholamdageshaltayin shinshindot shinsindotshindageshshindotshindageshsindot alefpatah alefqamats alefmapiq betdagesh gimeldagesh daletdageshhedagesh vavdagesh zayindagesh tetdagesh yoddageshfinalkafdagesh kafdagesh lameddagesh memdagesh nundagesh samekhdagesh finalpedageshpedagesh tsadidagesh qofdagesh reshdagesh shindageshtavdagesvavholambetrafekafrafeperafe aleflamedzerowidthnonjoinerzerowidthjoinerlefttorightmarkrighttoleftmark afii57388 afii57403 afii57407 afii57409 afii57440 afii57451 afii57452 afii57453 afii57454 afii57455 afii57456 afii57457 afii57458 afii57392 afii57393 afii57394 afii57395 afii57396 afii57397 afii57398 afii57399 afii57400 afii57401 afii57381 afii57461 afii63167 afii57459 afii57543 afii57534 afii57494 afii62843 afii62844 afii62845 afii64240 afii64241 afii63954 afii57382 afii64242 afii62881 afii57504 afii57369 afii57370 afii57371 afii57372 afii57373 afii57374 afii57375 afii57391 afii57471 afii57460 afii52258 afii57506 afii62958 afii62956 afii52957 afii57505 afii62889 afii62887 afii62888 afii57507 afii62961 afii62959 afii62960 afii57508 afii62962 afii57567 afii62964 afii52305 afii52306 afii57509 afii62967 afii62965 afii62966 afii57555 afii52364 afii63753 afii63754 afii63759 afii63763 afii63795 afii62891 afii63808 afii62938 afii63810 afii62942 afii62947 afii63813 afii63823 afii63824 afii63833 afii63844 afii62882 afii62883 afii62884 afii62885 afii62886 afii63846 afii63849uni202Auni202Buni202Duni202Euni202Cuni206Euni206F;uni206Auni206Buni206C;uni206DuniF00AuniF00BuniF00CuniF00DuniF00EuniFFFC afii63904 afii63905 afii63906 afii63908 afii63910 afii63912 afii62927 afii63941 afii62939 afii63943 afii62943 afii62946 afii63946 afii62951 afii63948 afii62953 afii63950 afii63951 afii63952 afii63953 afii63956 afii63958 afii63959 afii63960 afii63961 afii64046 afii64058 afii64059 afii64060 afii64061 afii62945 afii64184 afii52399 afii52400 afii62753 afii57411 afii62754 afii57412 afii62755 afii57413 afii62756 afii57414 afii62759 afii62757 afii62758 afii57415 afii62760 afii57416 afii62763 afii62761 afii62762 afii57417 afii62764 afii57418 afii62767 afii62765 afii62766 afii57419 afii62770 afii62768 afii62769 afii57420 afii62773 afii62771 afii62772 afii57421 afii62776 afii62774 afii62775 afii57422 afii62779 afii62777 afii62778 afii57423 afii62780 afii57424 afii62781 afii57425 afii62782 afii57426 afii62783 afii57427 afii62786 afii62784 afii62785 afii57428 afii62789 afii62787 afii62788 afii57429 afii62792 afii62790 afii62791 afii57430 afii62795 afii62793 afii62794 afii57431 afii62798 afii62796 afii62797 afii57432 afii62801 afii62799 afii62800 afii57433 afii62804 afii62802 afii62803 afii57434 afii62807 afii62805 afii62806 afii57441 afii62810 afii62808 afii62809 afii57442 afii62813 afii62811 afii62812 afii57443 afii62816 afii57410 afii62815 afii57444 afii62819 afii62817 afii62818 afii57445 afii62822 afii62820 afii62821 afii57446 afii62825 afii62823 afii62824 afii57447 afii62828 afii57470 afii62827 afii57448 afii62829 afii57449 afii62830 afii57450 afii62833 afii62831 afii62832 afii62834 afii62835 afii62836 afii62837 afii62838 afii62839 afii62840 afii62841 glyph1021 afii57543-2 afii57454-2 afii57451-2 glyph1025 glyph1026 afii57471-2 afii57458-2 afii57457-2 afii57494-2 afii57459-2 afii57455-2 afii57452-2 glyph1034 glyph1035 glyph1036 afii62884-2 afii62881-2 afii62886-2 afii62883-2 afii62885-2 afii62882-2 afii57504-2 afii57456-2 afii57453-2 glyph1046 glyph1047 afii57543-3 afii57454-3 afii57451-3 glyph1051 glyph1052 afii57471-3 afii57458-3 afii57457-3 afii57494-3 afii57459-3 afii57455-3 afii57452-3 glyph1060 glyph1061 glyph1062 afii62884-3 afii62881-3 afii62886-3 afii62883-3 afii62885-3 afii62882-3 afii57504-3 afii57456-3 afii57453-3 glyph1072 glyph1073 afii57543-4 afii57454-4 afii57451-4 glyph1077 glyph1078 afii57471-4 afii57458-4 afii57457-4 afii57494-4 afii57459-4 afii57455-4 afii57452-4 glyph1086 glyph1087 glyph1088 afii62884-4 afii62881-4 afii62886-4 afii62883-4 afii62885-4 afii62882-4 afii57504-4 afii57456-4 afii57453-4 glyph1098 glyph1099 glyph1100 glyph1101 glyph1102 glyph1103 glyph1104 glyph1105 glyph1106 glyph1107 glyph1108 glyph1109 glyph1110 glyph1111 glyph1112 glyph1113 glyph1114 glyph1115 glyph1116 glyph1117 glyph1118 glyph1119 glyph1120 glyph1121 glyph1122 glyph1123 glyph1124 glyph1125 glyph1126 afii57440-2 afii57440-3 afii57440-4OhornohornUhornuhornf006f007f009combininghookabovef010f013f011f01cf015combiningtildeaccentf02cdongsignonethird twothirdsf008f00ff012f014f016f017f018f019f01af01bf01ef01ff020f021f022combininggraveaccentcombiningacuteaccentf01dcombiningdotbelowf023f029f02af02bf024f025f026f027f028f02df02ef02ff030f031 Adotbelow adotbelow Ahookabove ahookaboveAcircumflexacuteacircumflexacuteAcircumflexgraveacircumflexgraveAcircumflexhookaboveacircumflexhookaboveAcircumflextildeacircumflextildeAcircumflexdotbelowacircumflexdotbelow Abreveacute abreveacute Abrevegrave abrevegraveAbrevehookaboveabrevehookabove Abrevetilde abrevetildeAbrevedotbelowabrevedotbelow Edotbelow edotbelow Ehookabove ehookaboveEtildeetildeEcircumflexacuteecircumflexacuteEcircumflexgraveecircumflexgraveEcircumflexhookaboveecircumflexhookaboveEcircumflextildeecircumflextildeEcircumflexdotbelowecircumflexdotbelow Ihookabove ihookabove Idotbelow idotbelow Odotbelow odotbelow Ohookabove ohookaboveOcircumflexacuteocircumflexacuteOcircumflexgraveocircumflexgraveOcircumflexhookaboveocircumflexhookaboveOcircumflextildeocircumflextildeOcircumflexdotbelowocircumflexdotbelow Ohornacute ohornacute Ohorngrave ohorngraveOhornhookaboveohornhookabove Ohorntilde ohorntilde Ohorndotbelow ohorndotbelow Udotbelow udotbelow Uhookabove uhookabove Uhornacute uhornacute Uhorngrave uhorngraveUhornhookaboveuhornhookabove Uhorntilde uhorntilde Uhorndotbelow uhorndotbelow Ydotbelow ydotbelow Yhookabove yhookaboveYtildeytildeuni01CDuni01CEuni01CFuni01D0uni01D1uni01D2uni01D3uni01D4uni01D5uni01D6uni01D7uni01D8uni01D9uni01DAuni01DBuni01DCV H$< $$7h$9h$:$L:E:H:I:K:L:M:N:Qd:W:Z:[:k:l:w;:;@;A;E;K;L;M;N;O;Q;T;W;Y;m<:<><@<A<E<H<K<L<M<N<O<Q<T<Y<l<o<q=======:=>=E=H=K=Z=\=^=_=b=e=f=g=h=j=m=u=v=x=y>A>M>N>Q>_>a3>h>m@A@H@K@L3@M3@Q@TL@Z@hA@AEAHAKALAMANAQAYDALDKDL3DM3DNDQ3DWDZDaDkEZ3FZFkFqH:H>H@HEHMHOHYH^HeJJJJJ:LJ>J@JAJEJFJHJKJLJMJNJOJYJZJ^J_JhJyK:K>KAKEKFKHKLKMKOKQKTKWKZK[K`KkKnKqL3LLLLL:L>L@3LELHLNLYLZL\L_LbLdLeLfLhLiLjLkLmLoLsLuLvLxLyMMMMMMM:fM>MEMHMNMWMYM[M\M]M^M_M`MaMbMcMdMeMfMgMhMiMjMkMoMpMrMsMxMyN:N>NENLNMNNNQNYNeOAOHOKONOWOhOmPZLP_PhSZT3TYVfV:V>V@VAVEVFVHVKVL1VOVQfVWVYW>W@WAWEWNWOWYW^W`WeX:X>X@XEXKXLXOXQX^X`XeZaZq[^[`[a[e[f[k[m[o[q[t[w[y\Z\[\_\`\e\f\h\k\l\m\n\q\t\y]L]3]^]e]h]k^a^k^m^t_[_`_f_k_l_m_o_q`Z`_`a`h`k`qaZa[a_a`aaaeafahakamanaqatdedhdkdndqdwe[e_ehekemeqfZf[fafhfkfmfnfwh^h`hahehfhkhlhmhohqhwhyj^j`jajejfjljmjojqjwjykZk[kokqktlflLl^l`lelhlklm3mfmLmmm3mZm^m_m`mamemfmhmjmkmlmnmomwmyn[n^n_nenfnhnlnmnqnyo[o_oaohokomonoqowpZpapksZshvlLvqLw[w^w`wawewfwkwlwowyx[x^x`xexfxkxlxoxqxwfLf./13 "&+M69&@M Arial Bd ?ARLB00@0 *H 010 *H 0` +7R0P0, +7<<<Obsolete>>>0 0 *H S[ ֟:a9?00)ъĽ5ǛSV0  *H 010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.0 970512070000Z 991231070000Z010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.00  *H 0. h|,-.  WSu3* [4 Z%}XsjxqX)X^-bXq"X/6MJ;"V~!lJGj6 -Ӵ90  *H :>{թy=q#+(ߌe,ZbVkbEƢ5"r-| CMlX 5ʉp*}a qfbB="2"d$006C!FXF%`0  *H 010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.0 970512070000Z 991231070000Z01'0%U VeriSign Time Stamping Service10U VeriSign Trust Network1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.10U VeriSign, Inc.10UInternet00  *H 0aGܴ^i b1FI:?xZcEO n06- o' Q`5OTOз,B Ѝ^㖴"IBlӘV.:X"e匫xGBh[-}0  *H m`_i{p+b#D Q#tI'\q5+ൖ苧KsH ڋ %VNGWF8V!&;-%2Λ@GmGv0;~*1+ݰUApF-,~0 0 yfnжneq0  *H 0a10UInternet10U VeriSign, Inc.1301U *VeriSign Commercial Software Publishers CA0 980416000000Z 990416235959Z0]10UInternet10U VeriSign, Inc.1301U *VeriSign Commercial Software Publishers CA1F0DU =www.verisign.com/repository/CPS Incorp. by Ref.,LIAB.LTD(c)961>0<U 5Digital ID Class 3 - Microsoft Software Validation v21 0 UUS10U Washington10URedmond10UMicrosoft Corporation10U Microsoft Corporation0 0  *H  0&dm{AO o*q.S26h5IؖeS zpm̳*02X|k%gw #1*0&0u0a10UInternet10U VeriSign, Inc.1301U *VeriSign Commercial Software Publishers CAyfnжneq0 *H 0 *H  1  +70 +7 10  +70 *H  1Tm?-)ytd!0X +7 1J0H Arial Bold font$"http://www.microsoft.com/truetype/0  *H qó06nX?~lhEw!MTIDZj 4`/'k:P0 *H  100010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.C!FXF%`0 *H Y0 *H  1  *H 0 *H  1 981016201514Z0 *H  1}§MOV&K0  *H J2VT0> ^׳Ckk~wȃ؂SV倚00;z)0O6R8ouyu>稟o?{T >EA 2&en ܖ40e D燔   "'6GK|}  LNgi $Xarabinitmedi fina&liga, 6<!)/3'-1<"*04'-1`- (,.26-'+-15 X 6  & : &,GHIJKarab ghi endstream endobj 60 0 obj << /FontFile 61 0 R /Type /FontDescriptor /Ascent 820 /CapHeight 697 /Descent 180 /Flags 34 /FontBBox [ -101 -251 1000 1000 ] /FontName /NewCenturySchlbk-Roman /ItalicAngle 0 /StemV 0 >> endobj 61 0 obj << /Length 4 /Filter [ /ASCII85Decode ] >> stream ~> endstream endobj 62 0 obj << /FontFile 63 0 R /Type /FontDescriptor /Ascent 811 /CapHeight 689 /Descent 189 /Flags 98 /FontBBox [ -101 -251 1000 1000 ] /FontName /NewCenturySchlbk-Italic /ItalicAngle -13 /StemV 0 >> endobj 63 0 obj << /Length 4 /Filter [ /ASCII85Decode ] >> stream ~> endstream endobj 64 0 obj << /FontFile 65 0 R /Type /FontDescriptor /Ascent 820 /CapHeight 697 /Descent 180 /Flags 34 /FontBBox [ -101 -251 1000 1000 ] /FontName /NewCenturySchlbk-Bold /ItalicAngle 0 /StemV 0 >> endobj 65 0 obj << /Length 4 /Filter [ /ASCII85Decode ] >> stream ~> endstream endobj 66 0 obj << /FontFile 67 0 R /Type /FontDescriptor /Ascent 811 /CapHeight 689 /Descent 189 /Flags 34 /FontBBox [ -101 -251 1000 1000 ] /FontName /Arial012 /ItalicAngle 0 /StemV 0 >> endobj 67 0 obj << /Length 0 >> stream endstream endobj 68 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0.04999 ] >> endobj 69 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.49998 ] >> endobj 70 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 1 ] >> endobj 71 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 72 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.24312 0.67889 0.90825 ] /Functions [ 68 0 R 69 0 R 70 0 R 71 0 R ] >> endobj 73 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 74 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 0.49998 ] >> endobj 75 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 0.09999 ] >> endobj 76 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.77982 0.88531 ] /Functions [ 73 0 R 74 0 R 75 0 R ] >> endobj 77 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.29999 ] >> endobj 78 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.29999 ] /C1 [ 0 0 0 0.49998 ] >> endobj 79 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 1 ] >> endobj 80 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 81 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.20642 0.34402 0.6743 ] /Functions [ 77 0 R 78 0 R 79 0 R 80 0 R ] >> endobj 82 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0.00999 ] >> endobj 83 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.00999 ] /C1 [ 0 0 0 0.09999 ] >> endobj 84 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.2 ] >> endobj 85 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 86 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.24312 0.67889 0.90825 ] /Functions [ 82 0 R 83 0 R 84 0 R 85 0 R ] >> endobj 87 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 88 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.09999 ] >> endobj 89 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.01999 ] >> endobj 90 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.77982 0.88531 ] /Functions [ 87 0 R 88 0 R 89 0 R ] >> endobj 91 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.00999 ] /C1 [ 0 0 0 0.06 ] >> endobj 92 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.06 ] /C1 [ 0 0 0 0.09999 ] >> endobj 93 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.2 ] >> endobj 94 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 95 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.20642 0.34402 0.6743 ] /Functions [ 91 0 R 92 0 R 93 0 R 94 0 R ] >> endobj 96 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0.04999 ] >> endobj 97 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.49998 ] >> endobj 98 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 1 ] >> endobj 99 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 100 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.24312 0.67889 0.90825 ] /Functions [ 96 0 R 97 0 R 98 0 R 99 0 R ] >> endobj 101 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 102 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 0.49998 ] >> endobj 103 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 0.09999 ] >> endobj 104 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.77982 0.88531 ] /Functions [ 101 0 R 102 0 R 103 0 R ] >> endobj 105 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 0.39999 ] >> endobj 106 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.39999 ] /C1 [ 0 0 0 0 ] >> endobj 107 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0 ] >> endobj 108 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.30275 0.86238 ] /Functions [ 105 0 R 106 0 R 107 0 R ] >> endobj 109 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.29999 ] >> endobj 110 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.29999 ] /C1 [ 0 0 0 0.49998 ] >> endobj 111 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 1 ] >> endobj 112 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 113 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.20642 0.34402 0.6743 ] /Functions [ 109 0 R 110 0 R 111 0 R 112 0 R ] >> endobj 114 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0.04999 ] >> endobj 115 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.49998 ] >> endobj 116 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 1 ] >> endobj 117 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 118 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.24312 0.67889 0.90825 ] /Functions [ 114 0 R 115 0 R 116 0 R 117 0 R ] >> endobj 119 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 120 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 0.49998 ] >> endobj 121 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 0.09999 ] >> endobj 122 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.77982 0.88531 ] /Functions [ 119 0 R 120 0 R 121 0 R ] >> endobj 123 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 0.39999 ] >> endobj 124 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.39999 ] /C1 [ 0 0 0 0 ] >> endobj 125 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0 ] >> endobj 126 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.30275 0.86238 ] /Functions [ 123 0 R 124 0 R 125 0 R ] >> endobj 127 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.29999 ] >> endobj 128 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.29999 ] /C1 [ 0 0 0 0.49998 ] >> endobj 129 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 1 ] >> endobj 130 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 131 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.20642 0.34402 0.6743 ] /Functions [ 127 0 R 128 0 R 129 0 R 130 0 R ] >> endobj 132 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0.00999 ] >> endobj 133 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.00999 ] /C1 [ 0 0 0 0.09999 ] >> endobj 134 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.2 ] >> endobj 135 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 136 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.24312 0.67889 0.90825 ] /Functions [ 132 0 R 133 0 R 134 0 R 135 0 R ] >> endobj 137 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 138 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.09999 ] >> endobj 139 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.01999 ] >> endobj 140 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.77982 0.88531 ] /Functions [ 137 0 R 138 0 R 139 0 R ] >> endobj 141 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.08 ] >> endobj 142 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.08 ] /C1 [ 0 0 0 0 ] >> endobj 143 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0 ] >> endobj 144 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.30275 0.86238 ] /Functions [ 141 0 R 142 0 R 143 0 R ] >> endobj 145 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.00999 ] /C1 [ 0 0 0 0.06 ] >> endobj 146 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.06 ] /C1 [ 0 0 0 0.09999 ] >> endobj 147 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.2 ] >> endobj 148 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 149 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.20642 0.34402 0.6743 ] /Functions [ 145 0 R 146 0 R 147 0 R 148 0 R ] >> endobj 150 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.29999 ] >> endobj 151 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.29999 ] >> endobj 152 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.29999 ] >> endobj 153 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.29999 ] >> endobj 154 1 obj << /S /GoTo /D [ 4 0 R /Fit ] >> endobj 155 0 obj << /S /GoTo /D [ 4 0 R /Fit ] >> endobj 156 0 obj << /ModDate (D:20030513101159+01'00') /CreationDate (D:20010131090513Z) >> endobj 157 0 obj << /Type /Metadata /Subtype /XML /Length 760 >> stream 2003-05-13T10:11:59+01:00 2001-01-31T09:05:13Z 2003-05-13T10:11:59+01:00 2001-01-31T09:05:13Z 2003-05-13T10:11:59+01:00 endstream endobj xref 0 158 0000000000 65535 f 0000000016 00000 n 0000000134 00000 n 0000000216 00000 n 0000000344 00000 n 0000000497 00000 n 0000000628 00000 n 0000000759 00000 n 0000000780 00000 n 0000000859 00000 n 0000006632 00000 n 0000006836 00000 n 0000006872 00000 n 0000007978 00000 n 0000008250 00000 n 0000008505 00000 n 0000008781 00000 n 0000009050 00000 n 0000009298 00000 n 0000009570 00000 n 0000009842 00000 n 0000010095 00000 n 0000010341 00000 n 0000010617 00000 n 0000010639 00000 n 0000010719 00000 n 0000013340 00000 n 0000013516 00000 n 0000013564 00000 n 0000013684 00000 n 0000013956 00000 n 0000014209 00000 n 0000014455 00000 n 0000014731 00000 n 0000015001 00000 n 0000015250 00000 n 0000015492 00000 n 0000015765 00000 n 0000015787 00000 n 0000015867 00000 n 0000024438 00000 n 0000024534 00000 n 0000024634 00000 n 0000025744 00000 n 0000026854 00000 n 0000026969 00000 n 0000028077 00000 n 0000028265 00000 n 0000028446 00000 n 0000028634 00000 n 0000028815 00000 n 0000028837 00000 n 0000028900 00000 n 0000042496 00000 n 0000042580 00000 n 0000043688 00000 n 0000044805 00000 n 0000045007 00000 n 0000318100 00000 n 0000318307 00000 n 0000602940 00000 n 0000603155 00000 n 0000603237 00000 n 0000603455 00000 n 0000603537 00000 n 0000603751 00000 n 0000603833 00000 n 0000604034 00000 n 0000604085 00000 n 0000604189 00000 n 0000604299 00000 n 0000604403 00000 n 0000604501 00000 n 0000604669 00000 n 0000604767 00000 n 0000604871 00000 n 0000604981 00000 n 0000605130 00000 n 0000605242 00000 n 0000605354 00000 n 0000605460 00000 n 0000605560 00000 n 0000605727 00000 n 0000605831 00000 n 0000605941 00000 n 0000606047 00000 n 0000606149 00000 n 0000606317 00000 n 0000606419 00000 n 0000606525 00000 n 0000606635 00000 n 0000606784 00000 n 0000606893 00000 n 0000607002 00000 n 0000607110 00000 n 0000607214 00000 n 0000607381 00000 n 0000607485 00000 n 0000607595 00000 n 0000607699 00000 n 0000607797 00000 n 0000607966 00000 n 0000608065 00000 n 0000608170 00000 n 0000608281 00000 n 0000608434 00000 n 0000608539 00000 n 0000608644 00000 n 0000608743 00000 n 0000608896 00000 n 0000609009 00000 n 0000609122 00000 n 0000609229 00000 n 0000609330 00000 n 0000609502 00000 n 0000609607 00000 n 0000609718 00000 n 0000609823 00000 n 0000609922 00000 n 0000610095 00000 n 0000610194 00000 n 0000610299 00000 n 0000610410 00000 n 0000610563 00000 n 0000610668 00000 n 0000610773 00000 n 0000610872 00000 n 0000611025 00000 n 0000611138 00000 n 0000611251 00000 n 0000611358 00000 n 0000611459 00000 n 0000611631 00000 n 0000611736 00000 n 0000611847 00000 n 0000611954 00000 n 0000612057 00000 n 0000612230 00000 n 0000612333 00000 n 0000612440 00000 n 0000612551 00000 n 0000612704 00000 n 0000612808 00000 n 0000612910 00000 n 0000613009 00000 n 0000613162 00000 n 0000613272 00000 n 0000613382 00000 n 0000613491 00000 n 0000613596 00000 n 0000613768 00000 n 0000613879 00000 n 0000613990 00000 n 0000614101 00000 n 0000614212 00001 n 0000614266 00000 n 0000614320 00000 n 0000614414 00000 n trailer << /Size 158 /Info 156 0 R /Root 1 0 R /ID[<5c6dc7cf0fa65cec017db8af79823833>] >> startxref 615259 %%EOF