Powrmatic Space Heating


Shown below are boiler manuals. Click on the manual to open it. Alternatively right click to save to a custom location. The manuals title will indicate if they are installation,user manual or other types of manuals or resources. In due course we will provided the ability to search on multiple terms and by GC no.
%PDF-1.4 % 1 0 obj << /Type /Page /Parent 9 0 R /Resources 3 0 R /Contents 2 0 R >> endobj 2 0 obj << /Length 1050 /Filter /FlateDecode >> stream HKoH4+8k-\2{ Na! x2[M7;je ~U:| '$blS @o)m{yA ׷ˋβ=7F(%X-dB{`*[7|}<)Ļ<"zxIOyR銺\2Ȋ41Բyœu5X*GH8d,БNXp_uM$s 4byvuBk1)$*6y 7y#GhA>>ڳ[<0,MeDiٙkIp7>'14vyYCN@ _i2WE7E5" }o;CI$ q(8ǐSƼ튶E'LY?LR(6T Bd7;8Ϊʩu03(`C?;TXi J[eN8AzPAZRI,T.IE4N ZnrYLJ,yۢzr֖%9,GAahђ }C Ű[,Sz;Y(IWA^YXDqǖ9a{޾ݰdB船tQbx7vRۋd5_WK}UE~a=7c_Gyw{5M?24aMr>Bc 8t9szਂucvaw{;y{N eS_͗X3 d[k1$`|_6LIv6aEY¾-q5Ofq2*wκ(kl2zo;NF(B3Ќ(WvJǯmYKx]]7SUH=9J)&a]5M^mU&yS-]4^m|,d||r fTU?HM9Qit~3yrs?8) eWL endstream endobj 3 0 obj << /ProcSet [ /PDF /Text ] /Font << /F3 4 0 R /F5 5 0 R >> /ExtGState << /GS1 6 0 R /GS2 7 0 R >> /ColorSpace << /CS1 8 0 R >> >> endobj 4 0 obj << /Type /Font /Subtype /Type1 /Name /F3 /Encoding 85 0 R /BaseFont /Helvetica >> endobj 5 0 obj << /Type /Font /Subtype /Type1 /Name /F5 /Encoding 85 0 R /BaseFont /Helvetica-Bold >> endobj 6 0 obj << /Type /ExtGState /SA false /OP false /HT /Default >> endobj 7 0 obj << /Type /ExtGState /SA false /OP true /HT /Default >> endobj 8 0 obj [ /CalRGB << /Gamma [ 1.8 1.8 1.8 ] /Matrix [ 0.45 0.245 0.02499 0.31599 0.672 0.14101 0.185 0.08299 0.923 ] /WhitePoint [ 0.951 1 1.089 ] >> ] endobj 9 0 obj << /Type /Pages /Kids [ 92 0 R 1 0 R 10 0 R 15 0 R 23 0 R 26 0 R ] /Count 6 /Parent 56 0 R >> endobj 10 0 obj << /Type /Page /Parent 9 0 R /Resources 12 0 R /Contents 11 0 R >> endobj 11 0 obj << /Length 1161 /Filter /FlateDecode >> stream HlVRH|waL $lcW bsyXKk{9iW翿dcTaIzz{F\-%X{ɐb#i4Ӣ=2er;OiYhO̯o8z8NhKILWLyKXBtGɄ.S_(ߛ{Wa0Mb:F-YE ʇi6~ax{oƝ u|tȓ4jn ^ `lm)ǟd^K2+Z G+eeNVE-Oi%ɯ7,4 qC0S6 MBYHuWiIs2j\?ny0CW><74{yG R`y@S2IG teU)*v2 MנYfJJvGrEv\}ifzRk>5 _[@ wJ}3Mhi 64\٦NHn!W:7tW ,X z \УIKy+ڣ#8=B&ٍrY-*}.䷼ވWLjoժ^Cs\  KQ"%eQ.&^?\@yuH.ץd5> /ExtGState << /GS1 6 0 R /GS2 7 0 R >> /ColorSpace << /CS1 8 0 R >> >> endobj 13 0 obj << /Type /Font /Subtype /Type1 /Name /F6 /Encoding 85 0 R /BaseFont /Times-Roman >> endobj 14 0 obj << /Type /Font /Subtype /Type1 /Name /F8 /Encoding 85 0 R /BaseFont /Times-Bold >> endobj 15 0 obj << /Type /Page /Parent 9 0 R /Resources 17 0 R /Contents 16 0 R >> endobj 16 0 obj << /Length 20780 /Filter /FlateDecode >> stream HWˎ77PŠޔd0+]ѓ[΢%RUU1[(>)՛o.nZ抁v$m/^o<>~{|x n_А7LћP6(n5FZR_n <ϟOO R-; q__>{x'eKؾml?bBm7[>nGSkv|љ פ,Z϶:łhMΠ157b1Yp?/煝Uz4rp+VhR*&UaЉ0ﳆW 5j4. [1C*[ [ 霮 Y΃tR`KЌPD2~ZHZ/yuW ,϶22TPCb;H_M8?e)tIDy=ϖۄhQ 5H^bdn3, Ie~Mݣ`|͜) dWj$[M 4 YLDz3dh sGkp/]p؍ MJ M M( Mr[H)R֭1I@"Hqp I@8ҤR<ҤvH)R@]H iR11Hi6;Ҥd\=Ҥ`'4KtDSIGE1mSɚHwv%ڝ)^ax?jER ɚHx%)ba'kXXɚ2XXJǃ5u]) d!aJ"D # LIi!a%J"d!aJ"d!9>I"Bv# VK,$ H+ER;QvBYARNHvB iNHR;! Ij'Y;!I4k'Io Ij'Y;!I4k'$f,+8@^x ]$^ON@.*ry;FPy;Ls$B'y_]O%j CX[R$xCWK 튱AQ,;77 g3vNҙY[2~GH1y2?y’ӧY3G'աp˕s[P27YxS$&iFwsS# P# GecxR*a ! m; d!k=9~RZ&,=C mV~ CB <  {ӔXm/~Xx%p` '.Wo =4H㏠驛kc$ҭr6T*}oDp4}3wd82(abAq#J EM(䕉"%dɫ]/ ptXc%/k5=j?W(h5R`x0 J=Nw#N-TX\ڞ}pݩRٞ]YQ:bnikeeU$x)v:?X"'SkF~N v|2 "W8Y #IT{y>`fkCa7B Z8BZ[K[ -Zy;R[S)%UTHkI9T (,μ*z%ɰ6'ZK?ĹSw%J;.p\.k!3|rVredPuek3F6|818:t D#r\(!xZRQ2˔JguNBx괾Җ)*g#- 1"l0 OSҨf/Ս|>uu`E =LV=9VpV)FhoJC,"eZĿu|9\|Ǟ D-#1P2(x*W:ʯqYX7~U*Pj<#)Ts~{|hW!Yת@S"n7 n}[۷LJ_ݾ<>$lUrYu[dg +rwbx{3~rl,|u_&]^C/ZGJC҉}⽧ŀ9Fb>}}Fh>ӿ%3( y礃J1'p>SI^u۾&[mܾ/^* }b?P&z=KT)xŒ rKC:o2v>@0]д:} ?mI^I  {K=P}nEG/LJė35B5&OtZ]vc|mcF1$_v{$+Us KJE"d?g{ͼ=ʞDz1=ýع,J ϒUc?YteeVzdτ,"˷h޵+D!T!G "Kej(uE 42UxoC3!yE$_`?Lw$毝2טּ(8ރq^V KZqJ\sV4.'V q=mj^!>eY{17kr_Fi? rdηE@8O,v||11- | | | ߂o`[0- |z2| ߂o`[0*GiRшguo" 11傀r@c*vL傁r@`\0uyr:T.S.( hKrSN`)*D\: X;ErqL '*W:֦/pHk!1ʝ5,߮Zj( K5%c5ĔK5%咁sr@,kur@d\c\2p1Pnk8<d!o-:ޒ"L. H ȬKƴ %ڶ]lylU{{ɘ|@d`_@/!  ]sT֮9Kר` qs0c%i4 i[Ϩp!!3Nid Ȕ:H. q$Nx o%~CRc>Ô,?9糱,gKǧmd1=JHR10^"1X7":%U:5F5]nAK 2 `mdc2'^n$emtZ5D=ّ A^ϰ7!Iq WB~rqgJid-NZ强IrT$蔨CD#iruNM2'`t(Nw?!2__zz5N׮q9@%=)u,(@T5K*C͐i6*=]8al4n׉O9=C͘ϙd~W$ii#/ZM XBIbHKq,::67JH·0ō-~Эf"쏔O-tXSsEWVӝ:qܦW2[q^NI@J[zYu!]X9Kjy]8ȴN3p{uvŐuu0,9#GqBCtxWIeK #I4n _+| qs숸9y)'l_vt{4Q&bhUMhw;*#s;fڧ2P2>4Gg.2!:OA$tQ Qz{^=r#} >G< +9b@:h,N>Zmlln)r@j1KH˿;caˤ_e+I9 (&jtO=Bڢj7O5 ykYh9s/c"NK]K[55\/Kx5'$IP:R#$򗁉`lJ4~$]$5g  T\"#PZ' 狅G3ATwWj4UW ~j{H40J@">PCd}cXc>wBU,ʇeZ7vJZ(G揷B%t9y|ZHLЂ3=+oPBIJd vt`%%}-=P=M[A{:ЌY]PNϭQhTeZynY]wϐBP ,(=;Iɻà#GЙ6}ݪz(LjF uk,e)_͠q4]CIUY}En!,>`^=FC5_G2A3:e?v͞=^!@uO>L{ܑ鮥YFgtLhoH3#>K“iQ/c5$ WR'֑?$YJn.g( o2G8s.e`qG| L1Bfd!YEE ]B{h\,odO_%FzAj$_z[!Hbz6w?ƏcnHM>RCYZ fR?S P#8K~; O!ˡ 64rHZ;*~mTvJG,Edz!idc%ɤ#VL|hu7Π+V.^҃nX9ceQAZ6N}xXEIW_1ZE`slM O,yJC`~K|ا{7cU[pھCU .r|h| ,n8}K~Ƹ3m`#F_tOk,r֝AK+ Ƕ4ܞ<23(7ĝ}%Y<;8H}i}-w';$ϙ,Wx2vk]xry  2aP}q6'HQߖ2[d=q~̀BVN1@`jBaBzE:X{nP_jpH.PeCW3L m}a_dT( P=2ZYNqUɵ<>U3ٔћiih`K*@+q(c y{'Ð`ٶۗakP!1/[?'b~ʷ)JIVf۫CCM^ՐhBbGlUouo֭ +w1Bv w Bq'9m5ӋD5+^4{O D@ԣJؐZ5$A zhqHnحU?b6iAh̜!hMˇ,2^hqpOrp9f{vDz"l26B,3xOS+yu&ô䫊|y3k@c0H% fp:DZ_O>>ٿ=j['LP;m]7v9m="gaHg u~+?~aYlqֶz/,Lo7ʃ!UypWė?QܽʳvyFn8"ʱ"ѩV*W춡T?I?s_BJ$=>\ T A;K> RpG 8xd7R6YP0x )ՄhW32Β /( $ӽ Y4Ғ,b\L<R1{)nvжcGϋ{=LGZZ:~ B=mcm߻5<;:_:Ss *v4h Qy܏geed/> ! !yq( :l!pq\qr˺̬zK 0!7SэjTH^w#Pj:rʁ 3:vuN8;\j^!ϐ,dS!jx%CBqVwz/\ENhuA2iٟ.Nǭ_CxnPɈKv׆X V.gŁp C  SCfi"Fٮ]t+П8{Zu8>.s|L*?`x}wI8-{8yJ+Oow \N\2?zqwg?tk׿/,#h3 q8%B+_q\7iH97yI3I?"g7tn/1 , Kp`0W0 sL!:dRϷAhGrtUє"hJfㅠec'ÑeӲncUþ_6}K@% 煏y!C4rp+4Fr4B`l 2'- 46,V2uhmMh Y 6-[h#_hGEsX8~m]3 iKƷXpjY]x̕Jאr7udb&+ƧfRXж_ɸ[bn$%iIYřSnqvJ-NVnU9G9JWt ~mBi@i,{=ζeLBX^GR(Y<-z>Og^nPmN m,L=BY[T 7` -u8>6\n1]@e`@ky1:*bMhBwAf/WTr`oӲLJ*;L)t~09LqF[=ULs4l+e u0'ύqF]Pz4䆨^/ޱ +v'*&Κ2 *gPxu5@uY0QURڼjx~5!8Yz<}#Ęc#D;}v&D?@٭H" JNFJ8ohKpQc%G6a{ b[JՅCAhwkcʐg8b0je?; fXͷ[NjrgpB Ѕ¬k@ ǷfXӯBw#J}}tT׉|7aU`"'cn,G2-;Rp߼ _sRuk&~J~  VW [NM4{R(H5Feb~Qs_ |RbDe 9% %`Nq>!-; 7OI[灃7&5Y\Ҝ@%Ʒ[240MLi*Wɼ:tiy9 5I6$mD=#/Ԭ£P$Ňd;$gl~v텹&7@Of#sPd"u+ _+RnZZk=j=N{yIb'W+k͞+klQ՚h}̕2}Kb)X[}I|ҰKZKF{,m/ ǥq[k7W ɗx~Rs N贎&aS{'蓠04E߲l;oyBB(+xẁ~'EQ~+*hHdн7>p :,BB~|k򜀅<=嗲Fcܗpw=}7?_Ta2Nzlo`>|xВgd#c% CLĦ8>,8i.sK'x`}}T%iz!\ºPhR U_^p>)’VRbNYdxg,q73TJivLm^mik!,+F*gV;znҪ- z%zݖe ]]ݎԈYpe5>v1tE|pqC7ݘ}s/ir w_ O55d_C5͎qV( ՐP;y\fR]K מ b੾< [ VVC!j4fQ <9̤j̪QNs˪ 3??^jۂ'z,xr|)7uj!Cݡ1wMg,"C9Ɓ ]$WV\#:f;=8H;#K~XKGJtF1K{# S߿,@<6i_ӯ_i \Jpr_y* Akf'Ľ ?,NrGǗO :"ȅ߿}//%УojBۑ{MOEՐ<2 Pdsacu**˜:]n^,B 6ltKcڜr2=oL/ R vA1멡nP7ab(4oJp0d(}T rE9;IVRPiI5Ud:pEAȡmߊkkΪQvV5,wν:O(o6e0o:Q05%Jy4V.B%DQ^4v*NnZ"[NŁQ 0&I>N?v|j#J686>_$V[3l[ eGok<#t}b '( Y鐤مNjyIWZ 1ϋN"Ѿat2 u t'$j'Wy;Μw]oPϜv_NtnUqё;ĕD(pD pv^~.@B͵ 85&2T;e\KndJJ(QMr:2@&9zR3G 2%5I`a9PGC"1{#OĚ_{9XV9Xt\[U(900!ڜH=w 6i ؕ~.`nV#KmOvC"MKLΪL'LxҞI6'LPD\pr厀\5VVSl~:v.&+'Х\fD_`$OD:ނJb&q)uS@.BC m)}-: /s<О@Cyu>H)j0wvM66go}eH6qk2OvcPl4fZ{@URAؘr琧RM:ńm%WXC9t?3?, wjtT uC91(~J<*(WJPjGH,B%Q ״: }y״:*ԯi $|ӆ/ЬQ5d9KВ31QZpT918iJ=PGժ&i8V u*G:FPGWBvPtLw:*;B)Ml.2mb u4HǤi k(,G垭C9|,8/~~qkmZZxhRx,Eࡵ<"ZZCkx$pxd~xh-Eࡵ<ZCkq!ڹt: ڵZ{bZZޡ:Ci}coޡ;{bЪCܳw({bPZZCkk-vޡ;ʽ;{*wн;{VGECdTe % =*_9}׿ǿ>-KՖܩ&b~Lٯ>aI4qY&c4A~۬\P*k5 2"RQ!2l?ĦAp&`@$k&`I/l)(Mĸd" 1Yx_h8qǎ\$9Q1D4*o٢??edFqoviYyMeQTK4-Q)e+EH**PaOJ <:EIf$8H nCrFlr7tLP+chuc?c/e%+>ʳX}epcZt !ZNGI8Ƕ<ז1Uʎf d.yO '^7v~x,,)c|rY_w͘p|a*qf3dTCTT"2*2!t9S!8QXBcGOˣqx!Vx%9~nRxŋ&+\캽3p^jvg;)D8 Lr\`@:7Dl23p ^*Tp/o36vyFl8Pgeh7*@^ud#+T(RjQ[C[+s:W.,^J ݆ƄUD̪UPKIo"TeCYaZwn!`ee԰P]0֫X7tlW%`ܢn&'>H;K@ރ\J nG=|LVxx#ģ#"gnQZ'"ʗ`Io'G[c$}\$h~?bpp($Q_:JvnOWl;a@vOSsvy+~/j8-zJ .Қ-"TbG_[Jx07`ܐm~Gbx~ *Sv$ja˜\WhM&v 5+OfBVMdX=JNK2LOdز$,n/s8D>Z5mVyl^]d-^j^[ѡJp_ ^^NZ qbxuRp r_VhK&eK=b)30xV㖁/(Lܔ&M3! 5RȖcV"JI"WE GV|[=쓏0 ʂӝL.|`EڻNm$*JN|Ujgk?+$K2X 6$.乮<"qHTEy2)fA=a1F)k48ob'oFÂ3l"_d%u<>(q4V?ݬPDbXUAi7WI( 4*JPIߠRc!sAɥXο=C*qo`[t:aZjڌ[]&.b-{k?|o|ooYH;H'k6|CrR9˵D5"RzlV,T(Fisa%9hZgV|5[R-ۙ+re]Q+?LBgʋsQ˙ȕytÅre\YgV>bI=hr8FJ>m&[kqCwꭅrDs;,-@Y xk`ZT.Cyx8tvŒzW%$zJET2Q`IQ ΤR`be.i:$Ӷ$zof3k.^Gq cw'g4{fuyi;ʧj"Cju]n: 4 m]-M}ZUD׊Sla;bX^5̞ e5QBjuѡZ]E[SZLXTpS #Nk>2 B>mr)9$ۺ2 -=MA|#X)ay0{`9(d/j/T6Hk%!Q< X̟4˛ ȟGcWOfIjLOQ`LcNGsoy"u@Dm1*ȥJUZ0J舗`]'ًkN@~8/TO-Mi)*ii th7 a{U1r=,SaygjfgU/%C C`CJBg[4Bb澣82L/fO) Kũ-[TZ@R]nȱEcQV\1?&Ej<*.DòD$T"VBߪK_!*UKy^,t-Mds IJj4b*.uBXwʥκݢUH/HwDhת(ltfꢁе O2Ȯ2`* ,|3ry~g؁Fg3%n1<{slտ^]|>(O6aP墑4i5QvFe6`j]6+}hhHl-ɸP&B94|&u0vv'eNe8H:Q9[͠& y1WOnhJlUUENPQ35DMWHe#kU躩@@,<& L(F[* D-٥kB*"Jx4hiӄF5i4U =-U)X\+l)ƇR^m"OtA" ҭA X*(fh[4#@j${6EO#HEp0a䑇B|tnj6rMOPA!xK<_w|.H vWY.&E[^~xˇ|<=,?~/?_\R햫U6+P )keo?TL%^IUhh R,F_/_ےȂen+;wݷWhyTKw-H 0o_tBϳZgvflG˿KtIAuآϻ_Dt>kD\j,n>$}v(ڽA3NNj`a}߅*ΊMe.Ck`{`4SPaƑJjF{7q }JՀ@m(˺RJ]F 'wiN9\")FmE+08;uضxnlm??0V&Ue}YP eVP̀`ڭR뽷hWo fz{g/@Y}<ha 7p+ [q1U;+mPJ#a)Htwv{ҿtjA?qF0)#[(*DhY:\T#ё!F~t4$yFeBZsr,YH#r`ZzjkY1Җ/rq ]<ϐ$u*b9qDy_*-= &Yn&ͬ*lK=jHT: Ь+ hQR >ߜ[>/(ʿ,ruPrcQKY"-f@T|e*,'T\CS暤BR-ː 5ʁgu=<&)adrөgEZ=;s,D`&ir9㩊ڵ/k_>nCۖapSIv0MΛ-=l鴣#&/Y۫p2vˎ{Zmrػ|vzzn텛7n}NV+x5 endstream endobj 17 0 obj << /ProcSet [ /PDF /Text ] /Font << /F5 5 0 R /F6 13 0 R /F9 18 0 R /F10 19 0 R /F11 20 0 R >> /ExtGState << /GS1 6 0 R /GS2 7 0 R /GS3 21 0 R /GS4 22 0 R >> /ColorSpace << /CS1 8 0 R >> >> endobj 18 0 obj << /Type /Font /Subtype /Type1 /Name /F9 /Encoding 86 0 R /BaseFont /Helvetica >> endobj 19 0 obj << /Type /Font /Subtype /Type1 /Name /F10 /FirstChar 32 /LastChar 255 /Widths [ 283 296 471 552 552 861 713 242 336 336 390 579 283 336 283 283 552 552 552 552 552 552 552 552 552 552 323 323 579 579 579 606 969 687 713 713 713 660 606 781 713 283 552 713 606 848 713 781 660 781 713 660 619 713 660 929 660 646 606 336 283 336 579 552 336 552 606 552 606 552 336 606 606 283 283 552 283 888 606 606 606 606 390 552 336 606 525 808 552 512 498 390 283 390 579 0 0 0 283 552 498 996 552 552 336 996 660 336 996 0 0 0 0 283 283 498 498 350 552 996 310 996 552 336 942 0 0 660 283 323 552 552 552 552 283 552 323 740 363 552 579 336 740 552 404 552 336 336 336 579 552 283 323 336 363 552 834 834 834 606 713 713 713 713 713 713 996 713 660 660 660 660 283 283 283 283 713 713 781 781 781 781 781 579 781 713 713 713 713 660 660 606 552 552 552 552 552 552 888 552 552 552 552 552 283 283 283 283 606 606 606 606 606 606 606 552 606 606 606 606 606 552 606 552 ] /Encoding 87 0 R /BaseFont /JDKMJG+Arial.Bold074.313 /FontDescriptor 77 0 R >> endobj 20 0 obj << /Type /Font /Subtype /Type1 /Name /F11 /FirstChar 32 /LastChar 255 /Widths [ 283 310 350 552 552 888 660 188 336 336 390 579 283 336 283 283 552 552 552 552 552 552 552 552 552 552 283 283 579 579 579 552 1010 660 660 713 713 660 606 781 713 283 498 660 552 821 713 781 660 781 713 660 606 713 660 996 660 660 606 283 283 283 458 552 336 552 552 498 552 552 283 552 552 215 229 512 215 848 552 552 552 552 336 498 283 552 498 713 484 471 484 336 269 336 579 0 0 0 215 552 336 996 552 552 336 1023 660 336 996 0 0 0 0 215 215 336 336 350 552 996 323 996 498 336 942 0 0 660 283 310 552 552 552 552 269 552 336 740 363 552 579 336 740 552 404 552 336 336 336 579 539 283 336 336 363 552 834 834 834 606 660 660 660 660 660 660 996 713 660 660 660 660 283 283 283 283 713 713 781 781 781 781 781 579 781 713 713 713 713 660 660 606 552 552 552 552 552 552 888 498 552 552 552 552 283 283 283 283 552 552 552 552 552 552 552 552 606 552 552 552 552 498 552 498 ] /Encoding 87 0 R /BaseFont /JDKMJI+Arial074.313 /FontDescriptor 79 0 R >> endobj 21 0 obj << /Type /ExtGState /SA true /OP false /HT /Default >> endobj 22 0 obj << /Type /ExtGState /SA true /OP true /HT /Default >> endobj 23 0 obj << /Type /Page /Parent 9 0 R /Resources 25 0 R /Contents 24 0 R >> endobj 24 0 obj << /Length 6247 /Filter /FlateDecode >> stream HW[o~7r7r@b'N)'E-6J!iE+E€$s曙ݳ@oG1&(b4_EmG^Ռ(B|<>C v0K4"E67ENDM|RM6:U>OMU{UZ~5Wt=y}Qb<'S8ֱ 0 Sv^!qD߽9]]ӘH)0IyARM/ )&otj,X@Ŋ2T ńa*M^elAip$= ?v(&[bY9=#l#*,n+>Cn YW>_`WA7ZEY-"Cyso"L=:b@~jSCmYzi\UY}K qh۬n`cv&/tPOz/ohvQ9pCܦx٠]Ң. XpHĬIBQ`*P9Ii*o,oԖ^&bk\9-|P.=ѰcZ;{PH:!fg B{S֫b67 m?AeEv)!xEL}ѹNZ-r"WOrPyVEVY<^xmz\G($zmei?deE.A޲2]u5,^O-n!\KxnN\TVMd>g8ơ¢+ˀYjYCwU #ƞe}&ȑluq5 CnHn¥<_ipO׫j;9ˇ>}_p{7ǔEƐ" Gz/[fȭ\hC i] Mpct &Mh5҇"mT +æѭYfA} @`8atVw-|fg{&#O̎A"usK&0!.>FCp Su*k~$B~j7uvA[%|M?{9%67]a? i3*/ 3$mէaV;  $v _-$  cw LAR|-{1 x@ޏq{wzmʳTvh'8D1[4 ;J: %jۋEs٘cXZ ~,pϏf~~ !`Xr^W$!vE7le NYئZ`)`j ϝ"$pJdXzKZY5#m'Feٶ')C3 XF\yҺ.Xz=hz4O0iL7QWB6v,/@ Cᔝ? D-)'CD}t9# б'|PQc$|p "߯=32^&;+_oJp" ?t|ZHY{W%b*lwa\[t`w.4HL|7֛2K Ф\/ۣi. W f쀡zɀsSAGrPOPʾw}IUe CCczKD,+V̓ {Ҽ@F 8Hs(;9. ͸pYb%4D+b!倚zH"AkFWkl<{Wtz8xb!.f`z{X4 %uS\9J:c=,b2(-{<.{[wtvYf+ }Sybnڨ4׎k`mGNx2Tm֧C6q&!pz8c,6fLNo2)ōͳ;ϜJs̳a ©܇,!*n^ƃljrKK I[ic M7EI*-垠4:(]H.JA+KLj0w5z& 7a;K[99{?.-H/"&r[״o?oQ.|<[kqyW/Ev|p9Wh 8@C_=e #~ oXd7`ZX  R'G%/2'eUI\U]gԹDŽ*Mb*؄-V;CT!Ȣ ) KK'Le(nJ|\ͨU" 'Tڬf \UPgVIY*eb  wfsP|~JB2XH9JϸrӔK.&R: Rc 5RKNUrSIĞFTRlhd @UQH]Y%uIpUjj*؜ Kt,pz|ѽrS:A%#ǔ65?gY^^0koIe{M~4m;VتޭJ떼cţf]ؕܬ)!ks:BorD <<1Bff>cg e,SgBܱߗYƼ Ow-*|23.# c{GyZ΋ q!4n4Y:xu[]m"뒔 Z{&8c98j~?f~5*Jc9iߚ-N^椡N>`2mg|diA6 caEM3/دt4Oԯr_M8^`CDPl|YDSB:Ր`M Ԕb//UsGb*ˠ >|ѥ0dMC:<&qaj]*[ljXoM*z7U@Rj3 Fe-)v bsO'Ľ F>~OjbQ,+6v] AU |ڈ2= ]zX?Xh>p63S×/ HPob4/)Mc7S,YPBi,:` ;,*Eh'a*r"339Bt&3\h4) @2:QV(`3*1gnR(KOWQ9)%F"2 s(PR*0(m͌"]1RgƉlJ"Lcٕy 3 ] W_>-W΅iV8@ʪ$"J"6U#YDeURes`2YeUHDK@i}s|tl6H)ĀFx4`kjHӝ1K.L~Զ(:9O6?lf>d>XH43I+In./?֐?cj-D?cTysS .1?]3jwt'ܭ{yy#\[<_zۿkj\mzHMQO̔*a}},t{9nΎ8mk:-М2Z1XԣA$a׬[tN- [FbG[a%B$L^voX$Ӳ|a^1rsa+i?aV_hZ&o+-^hvq9(` q @HH¸p.S8f}]0ko2ˇ f['Lk|Dlք :ϋQzL&;Ib?fw ۶L,/.2a<ӧ\qjojYCzU{e;go+>h}JgM=1G; *A#-R٭uj6gQ0/E*Rj.,[hfOd j6XR@i)5"UQr)uIn;/p\XHvCV+01V?}2XMvE%w`3XԪԄ(,E%:~&U\u1NU툲tjB ]'Cwbs>=!tq't4SԶ4M5}j׭"J[Ҁ(H) Y/1Q{=ǃiR Vs2hw}UV|PT/hRQ߾m뢣z 1#ƈA<> /ExtGState << /GS1 6 0 R /GS2 7 0 R >> /ColorSpace << /CS1 8 0 R >> >> endobj 26 0 obj << /Type /Page /Parent 9 0 R /Resources 28 0 R /Contents 27 0 R >> endobj 27 0 obj << /Length 3750 /Filter /FlateDecode >> stream HWnH ?$TH"Y}F0 >X}`Y 2_?/"[U*2/^;?۝yp~']z"+tO>A.V닻gooܾGo?넉x+"gcg:A(͆-BY8?=?{o qqdgsqH3$MV7~2Dj*{ӖO*ҭ*&n"}eȍD|QcW,ӂIU.s 74P,as mT1TL_|7X@vIųBxS hNM彴dl5ͺj/G_b%vy,gղ tgr`c?{,gWq3yy6Rd-v`_W; a(Y7SG|Mo pC㻰G3wL3,<ũƸ}˵m('mo-!;ْmwM:CG:Cͣ9)Soqe v7ilm% QJ2M"QmҴ`Vm KOsy<׊_zoZ,>"rDVD~N~80R6tĻxu75+lhW @d IKkԐ=<`ͣe,?J.TUYѓo=O沾C_@YڰN~"Np3}t JNr+QNirZ@4Gy3ѠWr$#of$tI%FYp3_@#?9}^*O'Y] ӫ0t/״=gk+I3J>S7 :ZC$a5`9^5Ă#tc+2d*9a [( U~iO2=-eG,ZPJتsM pm4r"ԷZ][d|Аiުp<ubᆫOdWDF僈g]hC:'H]XGY0qpY Mu_[ y>WM oȪ a#ff]?t*U*U`$)D2C+'i6KC2/(}r. 'scv~B` XknGX$5ǜVSrIQY55$0vF Ӫ0}l=~Ddq:1B@z1BeH]r͘]M1J&9 ',Yi<މ|,޵/ dG#1vS 9 EfqlugOn_3XG`Nr-ߡIߋ-9ʲ~N <ց2;F> S C m+,;]OkXD~/d?Gɵ-Dm5 ؑIKuCa\ ĔY QI=?^4L+OJ#_| LQhԆdLGhhC<( _U4%%=On.Uu OrQ9/q":E:DZܠXT# pVbbH= t_̟ |Yq%gos&ͤ(8/(B'fxNP0 3P]'?>q"֛YWY0@9gl4U΍,PB4䀁`t|$vW[q ~u+_Q #)\+]%NIu=Pgɛ⟆ߨC;VVm'g?U:AK?: ȣjiǂ@v AAMXLԙc$(yazEO>9Ŕ4 _;=]H0|Ch[ d o//Tǔʕhp.NmyOYAE[ץYcŠ7,SS9N-r b+*psCi ۅ!.}e(q}ኹ qqgy+1i"hSV–k]A>a]q(\4OZ i3Z6٣(nh8q@>LRA'':bVa3:Zy;Z-.\( G~=b?`jǃ#I&]:_kg7e*N$˖+ bBՃgՁ(#LAEroIP$@af Zqi^EzyHa'**4S]EE߫,8t3JV' 2_m endstream endobj 28 0 obj << /ProcSet [ /PDF /Text ] /Font << /F5 5 0 R /F6 13 0 R /F8 14 0 R >> /ExtGState << /GS1 6 0 R /GS2 7 0 R >> /ColorSpace << /CS1 8 0 R >> >> endobj 29 0 obj << /Type /Page /Parent 151 0 R /Resources 31 0 R /Contents 30 0 R >> endobj 30 0 obj << /Length 3727 /Filter /FlateDecode >> stream HWr8;aqDayoxbfc9t"A mگ߬HzlLtDZ" UYYYwۛ>E,VM<?r"~bU/H<.7_no&bۛn*%I4['78XbM8xx|GYQ޼޼m,$q4ԻD'%suSm*a۪;U"^Z%4E&JMU6BθЉQ"Vno']nUWQo_kb데2}Ob+m)υja(eѕ>i_O: hϋ6lPY*Mk'dQL2]7A䠫h8k|y8s]FW5: k *(tE? ֖cbV!E Nвpb!zԊ{"rr/e&@Ae ѪzkKU9 XI %rc_˦E!E,^ GOn0(+2B81|VGck:5pJMYjGYVƖo8:sEqP 0!߇Oi@ x*KTvNfU59{m7,S>#7J`KkzvHx"'P;1HRVHocP58p IO)V,GW]O"o O2v"8i&x6rBT԰f3 !9 cdkL28=5Y Fv6|Zj- ]𴖓Jׇ:1#YtjOTkLRnk, `LM ff?w古qw\؆e 6gga4?kY (V:sOlEpݞ0 ``RZi1&<-P^# gKIKUPMV#ࠥH`):e/BXj .tdk72_\}?l_|/VU`$L',2~pTKBbAHYʯ+ >YƉދS΅Q-l =I lVNT]jL<?^5C+d:xIrNcp8 >+4@YHoF.S!2}+Ćb:L!O:e0KZbx;*EWկ|ލ#_ t؂KX)p$$bƿVr.t*+w|$H72m9ѽ~<ñJfh`0- P!^Rj8U9ije$[O4wJtg"̓ry:^͢dw |Tbly 'iⳂ iyE,Z̺X NzNN_:FoU^:2jQA47\$g%[*.a382+J3`/__i" I$ENm:$:'pʽ(NmihQҞQa-Hco.Ȇ!۽{qj2uG$I0$RuKidԚzn{mnjcK阻fJh1ms@U,$<t-uf| g]X~| C<}y|O6/$d5Q:$c.s ybS]O $=\S8_? MgsYػ&%ĥ%5Y17+x׫1J[u/$.)V*pkq4!p9="ffwϑ ǧ`*鴎-&u"よ > /ExtGState << /GS1 6 0 R /GS2 7 0 R >> /ColorSpace << /CS1 8 0 R >> >> endobj 32 0 obj << /Type /Font /Subtype /Type1 /Name /F13 /Encoding 85 0 R /BaseFont /Times-Italic >> endobj 33 0 obj << /Type /Page /Parent 151 0 R /Resources 35 0 R /Contents 34 0 R >> endobj 34 0 obj << /Length 14263 /Filter /FlateDecode >> stream HW]sF|WֹB]I0@ yod: V~b|%fg{zz,//^-חɄ8K,c =$,72?ۥpG|__YMlϒ}bKlIvyƓ(bAV&h:fzRwIx5&!(3l4.a-*F>F5klXjYoI+bK|4f7IP.Ćd&3iG tuYF!Ń|}^z{VBN a^ B&#:%"_Ej2 זpq%{HMk/[lg.EЦ3AkNG svJS͈G^ P{z-JcDT5 YWrhfۜsHi2Ha"6P"l}TM1]3G 3=bTTH0C_xj74V%M4Q[S-f,0ׄ:\`ݩѼ6k?}C|?ɕϭQ_t&0V44rCZUę` \w_E!s<9ɍi$gR|jwi A-\K^F썕@. |M` O(~zſɪX^B9䖤UG_0h]i]˱e3C]MsWêEI5/Nϔy#"6> j$++wk@fOƍuD>G #<9߹ #P[C1{g>9 ՎڐM5I3%\|OP N'(V7/JUdIt[䡷 KNq',"n"w"jJOi7ndBp2HspHMz5D )@Ü׼E>(+ e h;DzmpSvsڣ0*Qi/S>):u= *y'Rj+eP TH%8͟.=;zmؓ=|_aEtM)it@BBY pr]*3s~?b55F°X~cɣa 0^6?mufsf[7;I|gKU0~pF3\i2ZtjN!F4iPe˫, !|,IDYϜvJö]F%W7E:z-1zK ^<5ew[fUY -RX1gYyb`+Cb`]JPĝ ^'ߓzi2³"F <7Q:E?޸^*{8a6 P]ݍ yE'4}j4{حL 趴ph s2gO%8r:Bn6ң(Youh l牦F6N͟/8;;4衝߁ݖ,9AQǭԁOi$y.P(a`0:B8ɟ,یpٹmwD\ -Tp('h%AH̽Z#=^a@~1yl"JYsӮ+nq4ƽcNJq(e'@/ k;I 0yZ>GfԽm\b$AL7pwli%bY=-+LY<&X x@?'y&ʭb%xAIa9].&QNbUY=E0%EѥKf|nuIÔǑyn-|90gzxwΉ\NE;,)P*Gcډ:O|jhom06 ig/iUȅHUe).O(N$hSM:dZLhh8-']wrֆx:lNMFۍƒʎE[e^-;7nPǹL @. ˨fHrTn1ڪk6]((c{?2Mݱ J[Y]tP[Ϊ|czۈtr8!?ctb^;+;yy;JX],+߹қ/VΜ BrXK/wčX(|h7yn/Ҵ>sk?lP)5O zY9ntet.[U5.ZsKcvPloH:\;@>/q;mC4DޏqE7?'TRm%~8-wq*bO?wnW&7bs98k^2;r}ewB"M}hQB +aVKKSXI=ݚVјܺ4" κzq~ø #j~j޸ bаnx&z>֙__r*d?3^~[ieIgq}| db/(S_E|I}*N~9ށLEgb8.ǫ9?~BCut=9`|d=_)zyh ͧyHTt!h;~Ў>j9gMң)_f\L땧ylqI0vo?#A"Mv*Dl’es$o>oE/enq05#-a,7Z00_!.ĔFlaLciA-@*L߶/U"仩G^ز^,Ƚ0Mʩ v)8zTOfx!"(+;xUKL A~ cWv*͇CU)@9:C84.{*ck7e8-qv!bI, &4124MONpL471Ũfx0&Kb#"-iW2GzOH^t 53{i%O.S9y-XpMCOM!i?+!9 G{{ \a/e8 X&Ԃ!e"Z)D p52=6֜{ TX*MCu:$**D<*.ܥt/ƱD4ЄH9PL (- frOSK_:^|V;SA?䗺_>gqgwT K  Hfa.]wa8M x>$zɁ-NlAxVv?PAh(FJ\Cnq IqՒ8;ڤ[H3ɠLБQMd$5;1}F[.|(9w @E \xX%’pL]Tꋾ'~du#e2EđT* @"E(N Z*2ɕX&׳J/&Ybe:b]썖:ochwjSiӎVk8pٔ&A%i~:*o M eaP)wqXxWR۰Ų.%wDAs黹_4"WW&/w"bwݸMILP YF֨aVT2qG:̰6Xv*dBOצ.wDPdA\CIџ[]I[JM}x:J,򚢦8X9_8 r:9}NPOgIDYDF-°r6z0XDE:BՏf ZSWCtϓ巵dXm]EߨJX)$Қi$)/qsiZDj4R3Q431*%Es+3rr FU͔YL$ mMfStՉS"P:5KX6 xҰuF`J=ͩ+(l)8~e#Ut1fQIa =sxjWXv;PB҂+ĉ)W^N=[&+FGTOjkZu\y59U>[}O0[M5Zh&PP6^ֲ`8T'x'}훞bM%%_xYtpfp9L#6J FiMEV3WF=WAxE{dˢ,jI]>]lJ.ON@7ת?-t6g5k'7&QWYkW`∃Q*sȮC̫2RvG!u@.1>"8Vj;uUuHJ5E%s ,5{E[tfc HDs,>6-1&ŘZIq]H$؝&o+8EbY# bL 2`p9,ma=&'̕纩 Bk O2쎒^/?iAUK N:JKG86M֚0`yEW,dLzjL.NIURk]V: &+VٕDp@ 8ӳ0>K?F=deF<Yޝ~Ag!F;558XZGUv;RQТ )jJsv“F:9gjI`BvNxhU&=3L؎DS[1$c9tCr+nƏ8~e s@lP|g.kXW+]%v,AK$ L^*Z,~?|a|6 Y^3PAFy0ٲ%Q=uWJ>#5kN]diV $&5;U,/VVEṐ9#  6g(i0K!bkl8ҁ9#R0oeކjnȂ} ^ujFB.ֲKԮW&ebWgdJoʆ1V^穲wNy;Cm&ip[+*N@Ӎw`K.1G,IJcaUdQ?C/*vRd[!p ϵIcUЈUR+BG`N ^Iދmr kNQ$Aω{#`P+)MBahO`f:wJHd++1'%!GIJyqTT@~ lV*;l[ W=Z)ıp& Q _.TeKx;C ԒLΰ` TD VKcdu,!md@:HhrJ )R֕E2U;hLY C.9:ߡB.үCiJŷaL a@#42~ʵ|մU/i8AUGHakKu iQ@z27))4eIUv'Qiq圧Q+: {>,@l Hg9 YBi#llSƥ5w Ҵ6-}s(p(.YGp'ްcZJA"-ZQ|L֧‹~K PV+o*)69Ij khVZ֢6eQN w7jgeܵ$ouMv܈̋,x,p를A!voۊ󹵺^ܢs#Ea~>|Wr D9lp@I mem 굙4E!1dr&;2йm+\ޑm%}t20/@ NG<ߛ9:AÒ.Pr+oݳ Vc"S.3N\"ާtŭ|TSoKrCa1$.k<*S>#& M%sմj#ԭ5Wc i>@UiB/s[Wj3O9  ᆏ, crXهaQC/&:I傌"Y u m6w %vY*߽Ў˥z]map7WMfGšSXIS<ѽDaƢ/P3rQTTEbݙ׊Be򉕨.,V`|] mj{rgF9bUlB*R㻸;.cd}.WﱫL6\ PeXuh9b-ؤ$5"ljT :syR〥 ?d-rHaKKdUSU{&˜xZrݙLu$ⶤ*P֨.r7[uB~4K=9$2yzfߝܬrvxLiؐ}; 䪔̱D4͊ r*x9dͦDZ:U8ϮTQ5ӆ^I[ k^ 2dZ1/$'xڿf0#I7Қ'+g_b9](8WTPkB tngFHCH;KhsGߣ__ ؀#xi31-5j:Odcg~֬]1U fdPSJq$Pv*'F+3>R-}C՗tJ^pi/ݬ/ &ޚy0R`ҵO*9ҏoIJ!l(*?!҆Rvh` 6WXDWBnJs92F{*!P0CqClSwGwG&8D3D;Izf#!IϮ~ۚyK2/tT~I~y`2jٱ,{$ᮑz7 #).=;oUWӕKTΗpD?!Pz76ٟ7f*.(H kqP?>)ߏT,"!\cDiYXHcW0(2(`G6ty+2M*Id,1z):z\g.U S݉IV=bjFH<9k@XInɀk2mCk .^[*h%O+L8ʬS$;S)4M*C #eS<0+nP1O)XofyJM{;۱ ;=fCN*`Ne$7$! 7?gkbr섰Y?`4# Ɩҍx l6w\`V*jSTz{^Z-5Ro8E>gd~p YLG)"P2eϮi3iZbSsdLEZuf[g[hVOw15oo6DO3_i4eY1!uI]R~ ,)5H x{4y,=:oxs@G04)3޼.Hq#VT]26BEK=F"ђ4EtQ&DӶ)-VU. EZcsזe;)Oi¨U.h7x9w]/kuS32-qAP1P0&nolr`k\ 8- Xܤ*$!`)QL˥$iAqjg9+ k';;98+tɊ^ͧ(7%5j$7cSg.f@oN3OWkm躤D5@#Fk##ymk1yINḞ?l[׃vhW{u*1%#PŪlQ||E5LZTU 0^"zlc_OiX{X mˏiP";31@_ ,űh+bz1bgCM YPL")D`"Љll{E{p ۬J egsIY$$IӬi4 %z>bc"&}.⼎\p73n3:5 =}\oS(GBEAt"N̡IXS<`dH(2e2WG*Ssr]dյݒud Rre>!ty 6ڥsp+v`:fL2y{lZ45.>Nc&˝b-ֲٻo,$D>~}`*"19%09rWqùM9MRo=)/s/eَe}r|gNC6-q`.<<׍G&繺GFXf4ꍇv@]x8󩇣QBymv@3x\aٞyhm}f= EKNt>Tx8HexV…bƥGsim!@:#%`So\yKP cǾ#d݅|ID]#]zı0jO>acsЪ/e.(Հ-ۖuPc_My1e`K9\6F98@f߸Ծi\0Bݸxm# *W.9Zrig'~c\ҊW]^y,)_%KL_ljI?[د  (Kű ,Ƈ~sXTw{{J;J]1 gWɎ%0PG@?b'@Z<ȅKi~YL2"зX),ԑB煶4(W\H30C**-X3K] h ^u>؁WAg<0ȇ8OQUNŗY8SE@6弙1o+sT~z~_bl,91 )N @ Ud0B WP澺1O^tJ@ˆ'fF>ء2p)è1ʙA:E.㈢P%vX A¼vi~1EGk*LDU.cʂT+ 'WЗ˜Sf<vR5v ]\L9o5N QuwmƱ'3@- g&X=`"#'S[11S{(sr+%LaS+5r%˜ n yT$cu4}.igܒT̸W*T9t\j>^/|@@gNI)+JyKT2)1 <6IͤYFc`x$ƨ&VP1 E1e>bTڗX4g~+$" j~ /I:SACIݦL ~qש#6ˑp٤r|M>b_E8N79[}&RtC6{~*|oHoDPHkΗO`;cף]AM2,@CSe>.;X⍝Iݚܐ1x38KఀbRQ"<b«AktoZӎ  >.*C2iq+I=*"/1aO8I U)_ uWWh]b-֊,M4d!EzԫF5*3\Tx>^RLn!r .>ʴ+']R=DG+TBpӤ]mۋ/ȭr(Ca?}.  T&n=扡(Mp8RӤ~2BGWәh>9awՑ&0>it½x|$5薣u"ʹ}z YaL\UqD9e/~ nmv`Llsq߿+YnD1@ DY/!o|Eμ,뒬{ÙĜ9i] 6~qKNQ~>Y"`yDW~s ww;+eo]~׏?ԩW endstream endobj 35 0 obj << /ProcSet [ /PDF /Text ] /Font << /F5 5 0 R /F6 13 0 R /F8 14 0 R /F9 18 0 R /F13 32 0 R >> /ExtGState << /GS1 6 0 R /GS2 7 0 R /GS3 21 0 R /GS4 22 0 R >> /ColorSpace << /CS1 8 0 R >> >> endobj 36 0 obj << /Type /Page /Parent 151 0 R /Resources 38 0 R /Contents 37 0 R >> endobj 37 0 obj << /Length 51593 /Filter /FlateDecode >> stream HWMsFJaԖ9 `o7*)و rH" ~_>(ʩܷT%Ùׯ_7[]_~0V+X?|HrDNukX;vUVkjoV\_}'woi쑉}`֘`%yӔeyN[ÂR.Yu}uw}< k!5GWʹ>8ʣ(uHu}욺b_= +NZTO,F{6-+͑UX=@#h%J62Ek8[ ;Uݱv_Ն5PGVTnqk;Xg}ۏ &\I]5CLd؈2wι fvqחlX!'֕Z_&GhZ١{w#=dήj[!MӟP\`[ o~? Dq諮ǵ!QXBd9 W7X@! d*HhYqퟧ_D'ݧ|zfȋ:O Ⱥ\~ P!y"ڣj!sۦ>\Hiڿ,wҪ@mU 4eK lS3//^A,_8{%G w RS/:)ifG+XRwuO][퇟>zquޠz ahA2砆=oBdqϔiB s /=8Х?0 'z 6-,0!핦S؝i@_C :3 le(Ti[ˉqe]T/+ }gyޣ+UI5Qa^bh%0Л$)! =]AY+IѿIYTa$\ nu(rct9L4 nn σϋ@N>hI3T(M6j;̩FJ^8-wy*d| ]cr!1dzLk}c)c!gS0 "m r77g{q{MAmBBW@.kTeB r;]SmFahlMz~ e:k\*i7*r_1C-"VvwbZFcP IS0  _w= I/0S!yoKSni$/E"e;a Iߏrf-Z+lI%RDWLُWƘk4xu|.fO5uvSSS܏qFrHUZ08*4G)4- oIX%`6T8<4^'$fKRh4Bau%y"sVMpsȵ,hܐ[xxJCK0+ K*Y6d%,ytL*X g{Wl<4獞#cw>jt=4$Fo$O!D=w +\`'mӳ-i..mD<2Wte)t 23|-Z)[2NQordxF5<&&w=3e6,GR:42lVCr H|TN\9QZ.5VՏjf ځ0*Kމqeb '3Mk)u`,V&r]S:G ra 9OtL[Agֳ'X#FIQ.B]#BƊO5ȿO> stԟҙd&5o) EYHTt3,yH0 Shh:`cZrdmVjiud 5HvROCґ%己S l:A-.GD+ϬB8qW[n8J;J:D:}!KunebU1%Va^ƞU̥Fӣ1X{۷=v*3CwYP60lJ@d2BVI󲀭/nX AGcTXn%^ѿL,t`+e)eXj5,Obr 4܃mbBPOC5aЊ\=ܙDOʎ%CH{z-,xֺɞOBua=?_v !6WnȘ J)+Tv+B:0IVdphdv+vŸ7[~+۞k~}Q ^N}ۊE,φA c _ښDoЪzkrS+)>ߩ'<ߠΞ`#g*_| d[E3d1w/eB58T7qs'+< Fv)DŌL0|LsBD;XFgMݍ|Y_M58^+ȍ< ss祬 |1&ʂ: d&ɡwlþhiR=90߷AmAbUpM& 7LЏ@wOM!jpj~yA,b=b<:4tU7irG Sn =.ml$ԇA2{/ۊu(HGA"JsxA-1(="M>.[8[XO)AJD.?<2vz˔&I=]w߸|ݩ_d6EJ( nf2T.Dzu搥J102v}#5xFPN8X{RƁpܤ}/4򐧛+C+BhL&=ltXw5|Ǭm%շتZ-Hޒ#x} p]u٪*"9_rݩo'P:sv,: ‹ߐ6עw`AXRuOwQt^]l-r Ţ6{cF_A7#5_nNR#:.C b:9Rba5ʌ)_wo=jYSB0BקXMEkMqaD:D .pȢq.||H P xkxE(^ўtCXi3m0.&TY4^WY6sbƇ@-T(Hj=׿5ׄTqq6/.E:lF%ܚ\kc\2 r߫KegDc|J׈{A9[w2_y4n45/WF6W90"c&4ͺG;#˭p$@9Q M֥r\.Xz;k!ӏGZ؈YllӨc-/Q *@ߞGFA^X{S#N*;.r?@8Awm:Kh]?+^j]_0RTh:e* w3+R,NjDB= vjqC&_Ld2+x+"py$(ǙrDf74(͎)m&{2ne{p _}e=RU1]qΫGú;! 6Yк1c)a\f[O0%K4<urd4;IҞw~ OB1FO`n4Yn7r 7؛2+3Z~_f0Gx4na3lo-`' |!@5=@Lf)s2="q9?!NC%&gڻy:@Kї0RC&+Rf8Q%8nI%.ߝ&RzhF7:HdA.SՎyHH|Wo1JI])w}]-Hvuʡjv78!x=}n4[YbGvXFtrddͱ'oM X,!T>p.bծ3>OI]Rt.GGnwx[;mK:~}%C:;>[I"i)R{N]?vr<*ɑkǁ{CD hZ|4}^F-H"r{{5\P^Q%J(u iQ%J>ke`2jc$etƐt}4kiگ.!\ \&;Kv*G,qk}jlL)rS'Ɣ z!3 *0B฾y1œTء[@EʐSTvQXl7fVmo!ðle8K \7zbSzP(ۢ9՞,ӋHt'gSTLx16f&iW4k2YDٔpY+kFL JFV*%Y8p` NCtVE^Z"1&GΒ<⾴)n GH".ouq{%+XǷj6g aRugҡE 0[eSاm}iz]^!cȬU1;[RW\iYL9yt^e{oyڰ*d[P1,3/m7-< Cd`_i 0s4nQ9a\P[:W]z)i=yGhL9OW?d¾'S,RPdXVn#E[bݲg[7ĩf*qK}nKV,5){KIx k..wYBᔏ N2gIx17)S~ G FP8aZNT+Y= o،AoY6>t~sLp}/} f]nhs77yegw͟k\ڪp#ٷK 4w1 Z10O_(YGbƱC5nl&+~ $ЯG4 f(TgZÄK~7PwrEgM_[yde oq^.<.Op8!>{::&y_ZOx1捖ҥZeWqGrRFcǖrُUGhwHS!ϢfDgR^Qs!UTsQKCL lW}Tr r!3ؕ\ u,j{Ųw+ڎyP)PƬ~ ܠ-n_{>HDWfUf l|`L)};n o#lVXs~4]tvl\tLy/`VC:jq +Q?2g ߝ (̠Z?:3/nuG3G}4z+rm7ǝl 4O*L̡/UPR-OZxZ 4,xްFyXxK^8UZO- q@\">Ö"Vo7,J U ZcpNf}2VAk8XBbKCVns$-r!&qp;2l-s[84pM! Z~K7#\L'5ƺ2&+ 07C:MvoID0yF[EB^>\bp$.HpÜ]/fHc >Ɋ;%?ޫ Aw-!}ZÌ(QE4T\K/ɗCPF축*iHȬEP- e.7rD e7yp;H8k WWl!ڇiɖ/ kٟXz` JG!6qcAn~k1U[֯\Va)CX(k-][jDնv=C\혇W{Ju ^])vXׇE%,d%̴ ~t<+T䆑Y2ʹ d(_Tm/Gi>k D1Ď.[Q;$F?S a\?j4a·psʭDV\*G-c 2[4l R0i"[8tO5ceD[g1qd-avHG}sb'WVIf˗;nmDc9Wz߰=Sហ3@yCj +!7E[^}B)($_봴kpD7X\%rdt^5dcG, cgBK8QXUؕƢZm,~, b+`p:uwEP2)FRarYW/!GZMXW'&Wr+BG^GK&i"<H R[cH[`uVVn FM #\:U^kۋ,FA.==oqIveQn7ܧH+JњyfV*ِ"Sq hb$7+4J|⯈E!{8:*_I/ 4UצBvz6ӮDJhqhYVHQ<3J$ą2o11$Y/=N=4i?d0@%=I d墈Z Ɋ5JHD۔z[UgꕷƂK3gA S BezfX﬐@9TkQu|U$dydd[ RrTNzJ%8[%|_[+z *ڡ BM=h&P.=8AHB,pB]$ƕ#tL43(dO-Ab~o{E$j04/.ȸ'EiFQs6h%1Sa&'Q4r9tX5P//41!St>'(3lKm RUf袬M~X-+ɂ* $~tA'/xkݡ[#C9ᲜZl_2w^^@eQ<:qc@ +'tC܈L -Ԟb8sdF|:ѠrxXUy/; UBߙ "^vZ}Vx0<4$ְʡY#Vyӡ. ,CIKe;BL۠oJ*L%&Aإы Γ'IJ jd+^ɍICm&S&Ub-e ϱq4QX臊 Uʿf_ւʟuRƫ@DP!cҴK-!SK)z׽ޓjjoH=YW7ft mopXϏ~=m]H&~|?]1_ͯ Xԋ.^'7D''oHtupOǧ?}|>8=#aP%MoA"A6EAEx~z LJ|{|>D. 4mct17ê]:~5r^뢇ջǏ^4%>(c"!^g>#b95|~s ip_y鴜OϠ?? "&"՛TSVȊ^d-r/i4>-HO[CX≊u )B cέKjT`VW(5"ۈ`\!զ=|F);b4A_BtC -2oedg*RgP,UI015IvX5- ` tyE9Un`:Vz"͵wm#yW9e7JcTp_ KNDL@&@K'Q$v$Uݬ\ֺ/0\G?*_uѴ'`hκ6p;I 'of;/=@udXxDuOxBNIu ԎMN<ʛGHF>sCr imG2*|HhDbʐ861m!~vǑ|"%]DHW$Ax8hϯCkj2 Zk'ZMǁ85}W%K㫌]$7EB-nsɏErwDf_42D_eulk=R,3[~}YmMҫ.{pnl],wyCLoiqisZ4YWFW|1"sǸ+qd<{@C'v/ʩ~?kى$Io856ZI×m'M5XK@j(kViJW93zM<_qÞ9e1ƬpKRwE:3;6vMLu"ۻhp|eEx݄t41UVyJ$RNC`-tcMn'q@ǑLH 2x |(!:&B냧[$ϻ M]@xeaB+_} `~q+]țӁыCdD ams1r3XXP8b*yŸ(-7>CoV_-[ȍxHQx_&m\$ 8FRƛӎC6 oԍ>aRZP\XDd>|$?} 3EEɷx`B W>ht y*q}?CG>z9П2qQ+n7A½woה Q.,6 {L8SۥU.t~}m7UE w<}-Nd6CBŵsPҝ Z:#t;nX 3-=T@VL>PՊkM$ϕ;oN5v0[Q26ɜP24˅ c7.LÑڱ k46̱% N FFZZ1O~%  Ia*Ƃr0^#yпIG9VppO-{ fwz sĀ㝋q4㶢!]XR8n譍ι1\l?) Yi1^mؗY+M=g#FӫT  3ds19Slpڗ䡦x3 sO6M@qhS6ƐO[^:FL-zBq!꤮ b<}̣iڰfqHh2?nb|ꈫfN餧7Mn! YKEĒ dlSaadEB8^u YuQoE ԙ)@1*i(tNǂYH(ߌ5$Xي^Wb^R1p˜6q+22T| 5 m2kEF}pZ ,גޢ'4`0V+5QLR jqHn!:*樚xqs;fFnI+&!3=ƜO'R;T$jɭI)y7VdTw YX5~=QDvv+xN^ͮEqH0jo!z*楚xy%j[ Ȋ4>:N2ȸzImǀc&h6fUEFΠ`.~۫ߢ'hiMlbV`q\krL85B؛pTQ5r'w #bV hUߘ[ S~͵2Ko^m.%1ʺW`a/H6,BK[Ħ!Ωuc[x3.U `_r׵O-SwOF'O~q`"'okngi.Վ!Z~S9Գ0}鎭RdCW?Ww {nGK84?OԱuvo&8 z&'V4|4%jYjunZU=ZXPŢ"JaqFIN^_hJ:,a+%x|D>M-s,Ќ+q7Qq?ad*R_/7Tf\Ͳ :'&|bwQ`±"_nY<39D1b~&n&oOB$tQ :ȧI6圪yeTá+:J7`'H.MBIe*4?AF}0 wnL{-yzNmNMVƯ <7QSvοw)urbv- ֍8a*iϫE ۈ!TE Oi{)T3?(|X0Ec))Tܿɨ )~~3r%JB4*5Q.: > +14!*Vg@vr{듚Fs\h,hIw%kew:nDfgZye[ (8|Je;#jˡ[]խ9LjWrm*PbgQ4*6J}W>%Tj夾H>b]\nPrj /,΂yR䔭gr/n^ڨWQh')u˯ $湌[ЁucM8[4E K8ꪁfVfL\g'-RUf=p^3j =pݽ^EαmI>+KΒD|U˝gj]i^c*4R9ܻ%`:ſvSLgfAD!U{^„T&SqepmkmەNj.Uj]hm:mfW]5l4EpJ^wgJ!Uv,jwXkyhlM)V[>Leӗ0ϽCM3>4hC -#^r^n&\yKTy/uoyx5RQW=ۊT=ySzg- /: *1dgTdL۞C~}*9IJxHppq=I]E;`*V=0"g+/*5T@рyJFYuJ0þ88yX'Ը[TY  QMPe7d*̱!(K@/Tr+>[Ç@nȟdy# S,o|$uv_Ek,aEä *@S3nmCdfuϱ@#!IPC-,q)k꺹{$[BnkӖƷNBi]SKd*Fyqi\}RRd Ȭt{]AS;dBsjOp5c V$Oġ+׋.vo).d9&~M>Rl p[zgySݬjO^ \`]qfޭl=.FW4Q:yS۲Q\2=M*vPU|X|W7?P*~եRIEbbea>(qYoz|?V 1euU/1PfR(_)1V^Rb2yP{<;V˄iJtb.ϻw6upԻiֻ#dc#^ϕKۂ 9}Lʱ P:`ib,B.jV5ˋss#z}_ZhCʊ/]=莉2G"|֦61,cQȄg~M2x~[*wz%RJ!sDlT@.5QYY'qEX8xw신$3')Yet 󻫎)cb ךU"g ߩ·0Ϊa2)\1Sڈr>BKVgKʡVlgŋu* /{n|J~8Bw.Kh˂N؄:ػŠ<tXq9WOK!u>_&M[@p,6 eaz&=z|!ˌšfĿU HaWm ( ?Zٞx 0(B8٘'@8p}-Hus:4)xF@D[z8 ]Iqb5y7OLL x,~L9nwTra{ fP ;E:"ӫgdcvcĜs>2靥tL9F ZB@X. <6GngW4qv * "y=0U8k}dtbFsԾ~C^ihڑ&8dk|1m I[!x̒}$Pܵ}j4N~.|?B[GY]_PMRY+hmV뢈,^ߞ3{Jom-XTWIH1k`U_-dQ{ܢ$p"e`寧;qbh,RM#̰0ggղz#Hw\s.jJX6,N`Ke1%MHqdۊ) p=ˋ&eü;NS[stC4zSVcjD/ ўn-eҹ?2t%(]5HxvXQM(AzgVB1tcGf P9?f! ]zL@mXpmK3nrZT8Ԩw(BuҮ5vqMj.gvK tAoe5cX̆yݡ*j?kd9+r"휮L{uQKK j{Gz a~4:rFV'TMB X,i0O~{DPf[Wv;x_br/<*WG>"w^[K޷>e wWkדLG[3$pfhhtj,LrrTytz1{4"Q *ۉEjs#3MB]Zͫ+yW]ΒG]vmgPZxYHOPя)#2g`^rrCͦ{ Opuܬl2{fMw),RJ '\]%e]O%#H䅫T l+ ԝ=)c9 OBq1GZxR{(ߔçxq0JDɇ,& f(TM tWΑetMq_:,LJVX3}T,$pQG (fJ&c_$˒܆]NPO5+v}}"#^T" H$Cej MC˜j9~$@j0zv/@ƇJV ,vН[(אu/ZI` Z4aPMTf[ XF> OBfLx5̲ͳ!~فMh/.9UXP dk -eZElB[6#K= ׋ENurpDfj JڵTōH9w8@Ed]{L0SZ !Nrd]pQmVsV/ΐpK>2GjԢ{&鞇`EʛpNm$DFtPױ78vH3;>\nϱz\Y^R==MQI 4ҏŃr6U{|}$~3?XLNڟG$895]?7Md@cAGi8gys{Kr7~ZeY#3@+s[Bt!>i}b3AK2]xq b^;]Ut2MjoOYM%n"V pk<""B5Exn c<-U)5sn<-̪/ l:ݜv ^]Sl'z7/K*p'kV%i ["'Jl88TMn3%Ml^A4`,niXml|{&,fx f3lKz^3DgQ<#~۱ 7]PKѻJ9 jp" *@ιSɌhLMV8g0ebjWSw_L1\Yvv zâIE&oPGQ]1,M; 9FUKmWApOr1kL.\}r_i"l 65e{ћTZT[eՆtmKU3N'8\0%ҩ7s;:V͹qʩ]h|Wrr!KHkFӞT.ڣQymJIt'eCk^H>ȝOZC\._52 |8e3ƺAK,C7Q;224S[t`w%#&]fR 䆁h䮮̆t S~U!FSΐ(nzD7΋-GU;ĸ |bl}`QH ?Hm,Ge_ND9LK_'Z?lr xOFK\;rkO,=*?8,-'4kWMn?ګ_<<~S}*m=䶢ud4.rh:9h)kIC!1$?6U~8ޘ.}U$,.#:kspeU.Eono)`Nɡ ?gc,-{aWoҜ~ܾ"_jUN Ou63.q$zɬL 声,u#KT}eiEYcoDVTst+a }wJ_W\/$oZQ[Tu%DUo3FwOV܎{uNRu^x᩿& aH FZ!2xЏN\@EdlHw7[ǣ8U!< /GeȣԧD׉iͷ= bhf>mjV"[k x+'aV߲FkM}PV$o8^V ~n[QUۤ ;1tԼL (đˣ-y4dhstgzCLdJB!ef+E!D6F#$:bQ]@,!&ķvZ"#2Zi )3IG{=6 \ä}>M&D0lk zJG ΄0i{e,naIZG#h_b.RTtߕM0^B9)h;p`Fm\ޣk/~. F:ZI@J_e@-s7؄\QZyb@1r@iiHTndA%*T+ r&jĘd33bRu+$sĝ4crN>h#X)@|hcŅW3Y,rVV!qRYЬ.Q IɁ8egߣb+]Ҟ{)H +&J[݂xUphY?|MrpB `)oW-c&e},&ШZ{HoZݢo؎4C聂m\ p\ s9QxpýV@ĹA;lw;mi64ήyNPp')ۛZXBڡsgپOlgLV3PÚ♙ҚiE*3^pr`PWM$/JT5•^Ǻ)rA_pާ*madQsŒ2 ,e*OPů$̳P#8Âmvtyd-@fk_uycaa|ɇu/΂o g>q2pY& fW:6{@oʘU-(N-5w=D=S7V䨈2uq^ԪpCç^eIEwWDe΍s3ZWn肊UZ2cO6]pR7Z'wџgDMG@<1v+Chpx 7 fvjZ Ŕ ݨ$)7w"qĦC:ȎK 5{ ܒyi;)|@ޒ pO0_(]n8L6SZΔ~g>멠]\\떥Łmpmea07bC.=Ervn>)Rp;i4TD]6^̡ T|NGák7?3U 1r5vp*ު6@QAJғ:4pZs쭀yjMu#)9+a`y崷rntI&$Y`.PC*f)ŬZ "vY_`=`)gE .J$m !:0!G+&) CA7>1+kːWtϫ IrQu娺Bn´ͭ q + .SZjWsĶuyxEas{I1ѥ)Sd|w5Oc*?_'تs 7(~U+hj[莊El-pB¥U^W^9P6.cRh0~CDl!4cVHZjx_|OAf8@݊sX)ؓ}yZUfKJl?!\dxZC9tٺ7v _x_A/đ !:&Jmn1oyB sp'Wdp|jS<:{`) ؋ܬ.Á_T %+E :}ʓWJ~ K (ϔoZyr7or7ix6L<'SdBW. tҪ: yJB=ߴ2@3͗!!Jŧ/y2˽+-!qaQP%'O(#x+tEF)[G#SIo,L4+!4#!E5HE% Z_P$\3ӓGblHLdVpdofCb+40\yDF)-STbvAsGwu|/֬O]%RaD@=V_UGLQgLB5sOhZ p4$E+рmORET9}"3.Tx=c׷^r!Ώ̆hfoCj~>3\3ӓ徍ِ6Ϭ~®S8;yRCAofCj_WC>SxZ;^F)k!7"ql]TlF4GC UCmr+?+3J=ylr#GiE?s=n#7.Py!H~?Ǣ ȑs6`8*j#8.~Ȓx>NlśJR.R1L݉Əyܒ%BF\GDZp08VloF2xŁH`N}_\تz/C1h(\= WI Ldca+rJ,LJJ"9#?@% o z5_ϥvx_4?Jƅ Cƒ UrnxhW/` 'zUZOBX}u=&k-E .'1~e7ʢ+] H}>yC΂ 0z"B Enٙ*:Sn K j*y] X͇ :a>'Z23J0i)sOڞvp]SBNP&\FNԇ-vtuxxM.(rLP kA8r]O?t*tX;ÊjF7GWErI8=Uq k'F`)R)G*q2YP1)n@:%06DrʥemIT3qGc[~#b.J5-e=VmD[_RؗVƈUѩyxMI: VPZYk';4ޠ;w nQd:*k{Roju׷$-Uq^xw;p02/8L ֿh> H[vM ѣFΦDbFTsؖ0ob;~&Ho_z.X_ t@C"4A.!aM^/QuݣyyVtnB[2t RH;‚u5 s[~7Sʪ:H:w&Q+]ԯpVOY#.GBFeFy}m 57#V.hߴ'P}$[oU}8fssv R L5wUgx#Qقl:,%fŗ-uB+ ś_ dXtB^l8 BIT|nǭb*dxQV%00^ذ!QCަ1I#H>kڱٰ!dɰn|0b]/OsKt,0dXuhG1OaC" ,KN#T0DVy Fe Ru#TkX r iZxyT{9Z@QNV8?$ [{p\C-|sigK pp"Iێ)zf:S]*Vʛ8~["E4ZؑF; <٤ `m&2_HV7╀kIt(z:<%){̸dwMn!Tqn7<{W$*f01UUK)ol113Waֹ33BcU抯 QD јXVs/n/<+H7C'}Iy-{mj ^"'#>O䷗K)b04⛥kFx8OvǷ%d^Z afCZh qhǏk[ 39m*sx#}ufCķD4S?,Mc@wC[phdmll4p#QSkk,.@蹡7;P5#!ܒ>/0Swnۃ=7ƻ!њs_:70nr p`h2É;,s?h%=\y|xL>X܏52cQ\B臇-oM=(LaOIWߛWӦ dD%y| Zj VUCpy'횊%PA%I-&vJsp=ǸӍDg&RԬlq /( o'NN1F{Tu#~Pc)zJfe#%v ;Lb>4k'?Ý ,Rˀ4O 6$C尚F:b-ü3$u9p9o5MX>i蝬߲ڔX%)' (Y/;l-.هHMcfK`(Wh3/1_r 'βl1G])2ꁖ8(L*ʯH49'"P#O]CnN7k̴o93w3)rM*Φ83I]5h3,PLιn(W(;9ٖȃ[Lq@nHsRy|b{eӽp\ Ke$ܕ't1yiw2Ghy%IӢ6s&%,}Xdk͜V&LL|Զ'iLƨSHvTbKv\H z$ji^%gr`m 3 aXgc,uU_9{C?k1S7jS&63ٖʥ6t;S.@91MvΛaug.\5``zY'=4O&vLp<N?IYPo _+ /?~?W(㡆Y K@EK!]/$i1#.e} Zg40zCKaj^U' v_۪\\f&˹>.ہBi銺TXTeC~,N\n"疔ÒQJ'B "-S@֐n׊A|^t&Fք5፛QE1` Q3/#fi!ʈ7~:oiv/+*e <&E]LMT=p9UD W-RKW`-ȇ  XDIax`y\95p|WJhjW|lیnnI=rPQ=pv 8Vs+V70bƝ ǚ=n= 4nl#pf}3@GqWvM, f zN0A:ٗm2p/2S#ʰJkB9Xd  BKO%{a٠bW8)xPƕIZ q4PV`H7@p\g\w&C[Ko';(] ! Vf p&]0*\ЊSΆoP LU&0.#P\d"<H:jput wD)GŸc(ǧ>tO?~ '±"MYQnD [x?,&I[e`;4QINvM*j !ZUiNzՍ=~O.IPk 3"=6% =PQ>xyb9[;DbD (L#+%JC+ROlL/\sa@%lE<"{Z2O<.>rs#|d% ws#\2&ŏ0=ت4ՇmJ4vH'cqb,܊ w~6H~^Y,Yh!RM)YrwP%$YϺRn8u +X0ot(ʯr k~!NY1_WO@Ax{4a&ְ\>Xӱ<"$u71~L6lFSߚ5ԬR4l"g1FOy_3; ?`XK0uU7׫>5*!fRH@Qg6f$kF %kcr $w#;D)]шjuG#рGʊޝ!]໥>hDhX Zhr^x ^%&젮*HV Z*蒲7fELUކڋt$Dx, <' Ԅ"z!y)EI!x~Sc f`GbC<´r#X1R( yH "Ǽ_$+T-nB=\׃&%U{IőR1B%kB;vK^G}zO1BItOPf!HT\n)4U,l-H!c}B0o!VbKK[vIaAzKGo-f"h/cZo{Bٶh> aTFDݕz6T\@i?I`ZͬX6V6X[T"1~itMe4ϥPo'a(\-mHb1#ȗ, H?Mh#!3'_lJ!NM l.H-tբxF++>GFZX_YNV窪hK+Ȓ}U?{PLuz)r=dŝU:vnJ|Ndžu=F;|跗t}(}0|ixؖv2iw!KVa;z:ɸ^>W]#,^tHv|;82%$#\Nܜl_OLcte#Fg/Ç;Y|$mtz`\Eߏrs+%>+q|nߏ/x'͹Xu> rXX8W,`pld& tL:nt U0L&r6;pD>ލ8 8Y|ZwnFvT=V1-!- }&}h94X x΂$[˓h'b5,31BXmC4/Hvv=4tE;+ XTF HxDFhF%0!Emoĉfϖ"@ܑ`5Dg:_Aq"0=r.V*qIRˤ"t#v&<2*^i۹p1cE4\Gځi;#c9A~9H9y:mJpFT`Rr8H暗;џE|̽0T.Z*Rv#/ͩ4{qMZ4I6@9Y*vkatMquu` Cb,+A5>X٦b'}{*3eKIe~KI۹:HځZ9=4C"ϊRwl܉p*\bc&XR)ieu^Ӫ:Ý.$Q^Q>mDƼ0&AO{fצݗafkLCi6Fbq{.8ve0yL6+SU+Xln]7LmҒy9'k-O`TÊ5^g\x5Jj}\<iRl*&CZ=qts=MRVaof|mb04"-R.'[\Pu"LYj,Ђ )&e' A+e9M>;iҷ [J3HE,]4YBōňJ'Mu[F)Xg'N(*I5D|r%g#,%̬ =Yn ?4|`a7--!*t(M-_N 15N~-*ܥPmlJR\1l"]2h[Cc #xS.T?Y8|Ym>8G8-c%DP1n)aooPny<^Upd^0 Va/^ƣJr26V{K (iA6S U!: |SR/,,{[ AՅYBtvKwk* 1}T^_l?ϩ?j1 $m4Udh1 :m0yE{-H(4ד~?U,GTiXܟ;%]-VDB}{dph[ ղjWrCv&z@hC@ 'Yվ)k0A}/7\V^+\dBω?x!_O? |W_!+,O{@_ߟW?a 5⣐К+/XUHCTSR86h"s$M#5QS%d^h8kZkFknc0BZkd< ADݔxsG_IBߏs|x ;u k=닖E & hEQ{l::hqtFtُB.nA3_qҵD) @.YtC?#M=z `5v Vt4e_Qс-BH?DkUJk^pIDzP5# x}DΒeu E&n`VdnyrM燣ԙ](:Z2Lkr;5քz޴%V,#X~̠h[EMBj4Q=jf3TYXՍ k95Tdjrw4)Ȟl8~D_aaf뫪N=3h5ߙҦX8^D? WGZ0 -jhE=|gǴ#͞՛ *F2J܇k8aɃk\D\c[>f5]iAl/iQn;SM187r-G {0!%WD .Tef7S ^@\rm_H'Pd}B:ܜ% -x斡ik5Ev3dɱ'#)H%Y_lsZƻo7LCB;Ӟ.KNɬ(!CUЏM2l,Ź)dp$ȕrvXOY>_=z~%' 5?UֹJTzTV[Ss 毡Ls꣈6I-^F\I#LozGc4 :U9]jš|5x/ZѽX2QtjgjRZ6k=w:\{ecEcp]3yd0rYY+zK&8K.ؓKMna5oŇIwE5+Ok'v=\^K[hC`d;R )Ě H1="MX,"e8+OvPF>~0qM[ω6;+C[}sɓk oI5+:\:"SDzerQ%Kk_$*uǏq$Cz|؉+l/?1F]E2Iu GwnEKgau/=r>eSY}`lUSV! JSL;JsC3m/EᮂW$S7)nq4ibOKqn Wj<['\Va%Z3%!JQtMidͫɏUQۄ[%lE- vM㑡Yȏ*p(Xl+[KnE]qJ?YPx=%̯Xnya6UyX4)*Qs2RBc2$Cw1bwO9;kl:@:ozm1;(;?ˋoyγoy7OLRJ:H\?]t,bdYX &:WDSG>E3 omIw6܌YXZz!u_cǏ!vիNpj*$B&tS°'mY|Q}Erk[Ó_,,kcuF< W*(j$0j^aGw9[ʻ!g{x5Yz*rjT81v$<P|f]tςv>TG bR`w$ ߊ߿ϼ,fރDKUd,{m'heőP Wsiq ۶L&2}.O9+51H#ik+B]_=_΍GOAß4Yˆ,l N<&O39.I]EZ:c,tC!l\#45Lto)T)-gH $dwMIdćKhV͆oQq@4{M$n58>xMW?j_5uswU>rz0 ʭ~*7̔ E!CM*S i=N.uRPC+b8c`Y-uleK2&;ߏ$pFw1Άq,;bc<mw9CqW;gu O.*#HM?)8p~-p]D!K҄W}Q?B:O)ia|3CZvEj\yo/e&fdX 䙓ΰ-6ZV P6eHHsO&z@i&Qp\%qX10eŞy^bGƊGlW;e JSZÄf 8qNl}>}.%{xH;ywIe6ۥ (Fr8;٧%DG)А(1ƅ0YW%υh\ʂ+~^@fe{Asx{ ]e) AS4m=7!I&p$3H,o]QYfpպPd*(ÂyzNӯ_SӉ=hI.5l}#;R42bzQL=g>A#n(uw~ Y5\$lŒw|JDvaiVզ iyH'(V|xlHߛ7Ƨhʇ =?0㽑Оa&SD2ӫhh6E}٣K̾3]=) Q ũTqp_\d>AqG`T7JC~;BJiNg*ܯ@l=RGFYngHA^=Ƹ$Qd: Rْs3'&JP{1D6GQY#Ú_Jѳ!sr{+-Џ)id'ׁAD~ j`l\eCwݟh4B [q3|1&ļ ?=$Q_B$N߆IjEoH^ZW/u^n\'wb g ч[sww~Dtns*bG u(X4ս=ҲRh/WNۛDR#]u@W }-&WF .)>%;Q5Iv2K,b_: ;_o)20 }!H(-D8{$FOёFC-_xr%@Ggv y~YXTi"tiiL#;G*ߤs75 /sʹK#E3qW}G"Ta>hKXB^=rkBy>Y!mgͶc=Q]t%\FeTiTx(rF~t#UE{b2 Uv38jթrFyP}M#0||I{\pׯfPI=D.Հc;mE6sbHu8K"ly  !ՙ|.n3[#T^W|z]zϬN4~#5{ |kޭLANp""Ѹ %r}w>Q8z`\Q|ڣE]er{#jjYXPϭNt,ʕ@mNweQnIȹӇD@i"ڻ:'q(m0f_ RTD䵟cd R{ s՚h87@Lޅ8Ղ+2T*Tl* 6 zθN5}MWln~Dun7k$h= |g Z{^ѤZ<[Z3NbR7Љm_8f9k("[C`'QTZ︵d<8lդ[ZueF`rO9ZKr޳tyjp!9l깫/=u8\6B"2 {.?|}+~+*3 QlzD{Qt4)BAqrJAh}EAFt'$:~ l*42VE8ŽPǹJMZW5hx9E3ꬵ  }u}k /~ڢyb0T:zEX'Y9 r?͊׈l^NFs 1UTW*(\$ⶳPWF |pdP!*+zH93( h0ms{϶g휐Br;}oPڷ̠3P;rn fR]hs.FRq.`kRGL?yr }]l } p&ǰ<'d,Vrh[’aqU/Ip{|û(K'$.5.d㛶`@&<9by-7bqۗ{V ؐ\e+W/_a`gDXCy#vnr,*+z~$dW%28!jj&1T;Ӕaq3d!lOg9LE?DGӾ`PDf,PEjT9nQ)ݧuwq>2;]AqPO.P5@u.Аgpu=%f1O"a<5OLI#L(!*ݏZFOfE9IįY/w.ʼnĝ{b>2Lҗ]' E/Vc7U,2^5 k\0|dKv:CrGPKy̿[u88> P >9gbߝgZv-w"cV 9bMqH!vK+Qʽ :6#7^5V]vB̑{wNJlok*k69 >f*C\W/^Y;\fkS,UDvL>gh:社/E΢ juT^u!Y] )h1๭+rб{l-ߝ$1;td׶/b08Up/XŒ:PF1;"vpïVeXKܖuI@wU?ipb$ɋoEƇ%O6_ٙV $";2htJA A' *Y咻--=2OW=D0!۵_seHna>쯿v<&"~69e%ߨd>% 1zO {)v.ns"\cg튠ye:Dأ*r{7r 2BCQFIpTTN9TAD{KpEw h5ቡ_f*TZ#`dd]م[ϓ5’ `@R<6vbR5zIe5D3FfH!`/]d0w*rSW/J/D4?6-h:؈kGRŊX?)n6S\oycJfe [3 nK R?m'_6g`mm]naoAT f^r("1PW'/rKmrwX w8'}$uQQmݮVx0cl iw2N`|'pge޽$D2?|$r\\ǪKõΆg'߭fx^~C/G6G4U7@G[׻ؿ\nvl++0r"2L2"eZViޝ$c~}*?\ek{鼷/ۘefpȔ;5LŋXG B{)W3oƠGq p|pGLN^~kx 2mÇ lBq|-{Z:]R{; Npݼp'[!acX~vh`hŞ9,BFr}$ ">&P9F+[=;[^R+:.ٵ>K>Weh7xLLU|5b[;4R gvHtX~CD5lyG|9W뒴Ve Ɖ-6:l|d ި_:Aof?֞yy-ۼbu4poRMCd:Y&ڽWg G\:; I6ồdRK3dvpr]{CRbb#ٖb!B),!bJ ou)2LvƆ*96;y-U&^;ÏC.‰q?_z=ԯCMZA-r#IoJ giɋoU~9^;{w:yh?<6Tғ\8Rh)t5Jyߓ"l: 9]|ЀPa@ͭ{_^^d2M&$szNx8czd!!ԫfSel{Z/-!!dwܝ^<M=P=WݲD7{KmHi-zFM,EHVX5j!hcr Xݍg.i s[AIO GlѬmrBcVR)|JYՖEi^Kw'R>䶒Bf)н,[:r8{Nɋ+;hFɳyƢѦfC]?>'wTz%C rivc;j<+Zw/IS?|+n1R|- Q(J\|bZ7Yxg6When՗fz'7ibxjލ<Rx4XOƆcd *{J;4Rfy7WVـdz$6n^P~gv lнHY!94;$JaHK0'K6R%O+2DYIZ6!_/l:5M:*㘵|4>פRB ]& 0q"䋿{'MW}$+D =ib+T)hZIc0Q퓠n7Uk_52۹C Sg:)e.Ө4WQH CY 횈W/Ttlb ؁w a{߶b&׾%!He>ټ6n,큰V($P'@qz ~03Pq}%DųcPW͇R-VK}L[g4RVq (e"y Ex%xֽKZZQDmb28v$\TL cMqxr11ѬD] Y8=g߁>>:5Q[pOZ4HW~:MChEwXm3ZUVBQRVP&z*%. `ATCe0U ,rKg_3E\T u1?/%X:df݈GMD-zZ[`1Zec[S~Zt ; 'Us(9i 蹃@ʹT[j ^E_+8TۛBb&RQ(.uLXl[`rBˋJ몇6.F*B(Eu$w0mSٝX՞v{kCNA H*'r[>uiK@+aJg_)]lB9ĮQWXUo۠u f39sn# Q&wkk]0%?S/|ؗqSh& R"ҫc3,ӿR\kL#1BOo=Hxý ౧x~>Qԥn(9B7~^xk;bf8[jzshsLƓTE:+1k!jc31eLuZo_LO0L;l'3(^K`9ݿוA'NG.Jޢ[y@ZNJtU~3*APvC[I.*QDC~_@p@p,ՔΊ)rON}iJE r8QYhC~zgq^6LiS7F>O.W*!$.ӍܑF75w1UD;j{h=aaӄ>i>g$hb`<`W/ uRXwU*R%!eW9QcS'S>qjFv`EO؏ED"cFlj9jr IpPB(vt*k7 kE"YmtH&`hv2ڧ# Hjx&sH"3-dJh}' j>)7邚6dtcU^g)#f[H؄>8O\e)h-G[N@,[t\l$LeY5).Ѻ1F;{M2j8f)K MpI,]ADZ=fib\`%*6h=ٳݫYfYƔ{/jLdgG6337jHzXt~цk {k(Ci ?~F*v-FYo5= endstream endobj 38 0 obj << /ProcSet [ /PDF /Text ] /Font << /F3 4 0 R /F5 5 0 R /F6 13 0 R /F8 14 0 R /F13 32 0 R /F18 39 0 R >> /ExtGState << /GS1 6 0 R /GS2 7 0 R /GS3 21 0 R /GS4 22 0 R >> /ColorSpace << /CS1 8 0 R >> >> endobj 39 0 obj << /Type /Font /Subtype /Type1 /Name /F18 /FirstChar 32 /LastChar 255 /Widths [ 276 300 348 552 552 888 660 192 336 336 384 576 276 336 276 276 552 552 552 552 552 552 552 552 552 552 276 276 576 576 576 552 1008 660 660 720 720 660 612 780 720 276 504 660 552 828 720 780 660 780 720 660 624 720 660 996 672 648 612 276 276 276 456 552 336 552 552 504 552 552 288 552 552 216 228 516 216 852 552 552 552 552 336 504 276 552 492 708 504 468 480 336 240 336 576 0 0 0 216 552 336 996 552 552 336 996 660 336 996 0 0 0 0 216 216 336 336 348 552 996 288 996 504 336 936 0 0 648 276 300 552 552 552 552 240 552 336 732 372 552 576 336 732 552 396 552 336 336 336 576 540 276 336 336 360 552 828 828 828 612 660 660 660 660 660 660 996 720 660 660 660 660 276 276 276 276 720 720 780 780 780 780 780 576 780 720 720 720 720 648 660 612 552 552 552 552 552 552 888 504 552 552 552 552 276 276 276 276 552 552 552 552 552 552 552 552 612 552 552 552 552 468 552 468 ] /Encoding 87 0 R /BaseFont /JDLEGL+Arial083.313 /FontDescriptor 81 0 R >> endobj 40 0 obj << /Type /Page /Parent 151 0 R /Resources 42 0 R /Contents 41 0 R >> endobj 41 0 obj << /Length 17252 /Filter /FlateDecode >> stream HWrH+BPGjB,c87y9X}(E,yY Ä"DP˗o//g ?bzgl^^x>wˋĻ;{m Oߙ 1c_ط=Vha3./B/^łG a=q{%Nm y[&y]U2&7'ّCF-EnJQΦI#N]̔*uM]ZN[q[UQAى6cd J)e nSb-&gZuq̈́'Hb8qݱY6(㎩%bD'9{g.t^-ݪ+ <7gI@ C հ:5ȆPXh=;]>wju&_3 %;GM_q{HΧ~n dg3*4no_SNe[y%#T+1S!U$@Z.j!iv :N #kKfŖiSoлHsX=~r$ٳ(%g7HWF^*أ5~`]DI{uu}Ȫ(.j~TuKC7bUI(W5ϏYE@wF4ZB'O9 *H8ҐfAo&_ zjݠVŇvBY6b)շi)O„EQGth:W!NRa.;4 ydI^?z])ڢ'e6ݭ|k[\U=.<Qm6ۺ0d5۩-@olɒi6ɶFA9\y%ݨEۘJE\yDK@nu/KՑ<R|Gsk]ivBm#+흽Yĝontx1毯~Qb!/ěr'Yrp⺽*Fd3pS+%`*:jKSR ͮn=fl(tnuet>cegǡQM%:'QHNmG=f G#zGHE@-P%&okIqaG%J-)!dRfͱ[wj"32{%M7#ZxWlC8IV%r-L܆Gaj3&EGÝΒW P+ߛq\ o䷦Oi[yM :7w萃wKy`~ţ-8)p4FbEG&oth)m'#ۯ1Y\"w+$m^MȂ'\'DJˣ[ -ል* tˀd9*'1yl`}i1=eQ`ܽL0U*P-v|ڈJ-1zL-Z:Hlzl6e}m~fqSJٝj(Eك B+t\XQ6D4!@om6;CelnWXH[Z͛ _ڴg \?e&FOJt ڮCD:y<"٭Zq=\%m֚$3s qlꅟۜ˧30ϊ%,ԩ"ިcjjg qrĶajx9~54 e.&Td[Xȳ$b_xU{yC_ŀT{%j!:$%'NHѷDɂ8] xd f[06Kq2'< " H^Z5aA47 e !^HJ,D]wSkA؜Z IƎM™54Ք:K]Iq\}LB_7x1R AMĚͪ׈Ԥ3Q(!ϽcI:/irq?&I[_t?G=: 4BY(rr,#rE{dq({duKAюve!NsuC\<nqTH p}Vxjwz>ùb^v3b:RlGHw6)َX<kk;dqny $c#cv*v1\1q@A%//D^ui^lι7JN{O6 zqs'u12i Ƽ1iLǶ!f;bYt!`3뫍{'t}βu>@l\ᝀXsyg1/;,AιL jrbLNąl}) ˖5Ƹx;`%CĘDR~ Nlƀ`c8ؘtlbHʙ =[VNk ܵ1X;q!V2*/TƬ-_jbu Ji0YaΕ/cb G"[_vha"E Z hzMHM6L^p*$>ߛJ8,MMm#B0( 6 ^Y0di4U)(,`nLt\ QZ1!A,þR}p#JPݭ!yǃ x!h2qS"Цyٰ/1lTri޹HRdȭNP-A٠BeY ^2"*^ _&hA!o^ 6%eR>..9nKު.@,d/y LN ktrzffTLº %cl>mQ\67c[*0?2p8Z$h#Ms!o3?l&V#D6!5/ArqXfG\~+d z=W|l+ц&ddNJnt/oՅ97WrYZV-d^ {In|#\2&~(w{^v~CQ\'燐8o\,/3GO%Wİ,d eʐoʆo}2EC&G>~ʕ+ TLGxM. AK!5<\WYG̠j(AFT,Y?%(.Bw;4UqݱK_;k~=#TL/^"fyNB(  HD$e_7m<5Pr0*k#n~tJsCFf,.gR#?qt,Eh{[)Dg<{<r$沓d!shn>:G[P-E]&۸ppK I}Ԑe UB#Hg PCւ(y=LՑ#EC=ɿ2BY[\&q@JDY]D|exK넎P'QrJ!tNd|:+fs$@Y-I:!9^rT]$RG 9Ѣ(]Ɍ(!e3` z fp<\Ro)wSUbV\SOBo'[VHN QHDS´t);P!HEFs˔q\r}ц/6r"DTqASzEAnF(AS0HL*<]Dǁ .\\WHd5Ke _]nehbzس{C+ee:UbuQ1U'T; J#ʗ w٘Gjr,_#Hs9jds6j;#K2jsp⢪z<52ٱXbއߩfD`E2E^`xվ?*>+^=Ŕu졩 YrDŽ>Ccb:/T$Te iC~,#2:s5p$inpsE #*Ew )\PFB#܅UMb 'üuCuy):cU:_aD?O~X>~hFc|O t0տf~6̺/sc jɕlG'=l_F-Nz9hTs0X lB&%> ) ?jH|QC}! ʔCtEMÐG) "12(e䧐 À]G)['2d_}ʪa߉k G8Ro""t)Pb=>{OVbcLfFyĈSDIaxDX#S&dobWC~ kl4P2"&qLױUlӗD@Y͗Fx+'1^zxpbf,D TnyZ$]_n`M -Ya".>IC =\ Jq/1EE+E+eUy//c?CyQ̇񃘹\ӵO=h,+!ϫ1VuYN2a뜵V V[ၡyaDW8E1 3F2뀪j{*S]씹z*⠛XzBSRQ[idpdvZ5S󷶽lUC$Ga8@J^ f#O~Wsct4MOiw̹H5=2$^*{.V'hş"]˲?X]{[{ qGj$󃪔}iC8z駧FT=7R[C3,*Iy{N&]B5ʸ9G|_,A'<1CIRꞬ)kz}~hw;٭FZ} ~Akf"#B*Cܽ(2; sut ;{&7c|G4%X@| PvĒ" :"7c~2d)WWUմqI~|a80l wť\:KCOhU@X= P]LR8AD.K>+AɳWえH ;haQ,hhI\PŸ^i)%ē`pL7+y۲3aR!1(<K{#81$`:BYMBeJf,qg;㖲 . s( ei vvg2=z*1d91CKhj(l 0WbbRW"D3a$~|<!`*R0vsQ6.&|~qe*~9] ttd@? Ӄ-7Д;{*ʋ7Ma)w_?⪦,;MGqZ1E13]#i>w|5|O5]ϤMr ƽ{"b'n}GW̿mZv}r2'-ǕmK(K9q[RIi.ve&Z(Sfsoオ8d2;Z󚱹 d,2\R5Β $]21xxq1T\8u|{BªI$j!Gx+Jsu?=EV,+^3y=i*{rKӅ1t߱_Ӭ |yZ{縸gV|٣.l:hF:HBOcѧT-VQ2FJ488>i3[O" kxFFiu@È91H))/“#[d|H|?%gjV=/RvhB"r";$y:UjHTۄf2x\ &q񮋟qxW1b3Ѿ`t2I\ UukyrU$KP׿ɮ *~@*W:fq]jA!Se;ri i.6s<4_aȔ\3>_%$ܸWG?hƻc Qq?;foC2X0=YXkdw !dQ5-rHm@?[" Q.c] ryjі'%˱ƀ2Pzw,8OG9& =&Se1(ɸ y|o9ƙgsw5Mh&ߍ"%rY拍N=ګn#^O5 M:66P]/G!lnQ!]=kE{ET<74{+߻hl~]xC ހa̸oʷ8TknU&Mo@K_;s|@#,a>i0ύNK}}ٚEin&Pѫ4dg60Z^{Ҿr5ϔʒg.a1 d7epvi ֤)$-# <_ʼn"jxI33DyQtOdca0/a1% +Inn˖+wxvĐ%s$p7@+O;z=`9ID WR'~X"|J{D>-v\m|YG\tz/ |!e*_xm[ZGdX@$:V Jxy;v.ˣ:𪎏[X^<TOաAWt;@\xRΤӑ_EWvKWp3 o$;Hgʎ,q:xtOU/zp(!L.3F›b?}c[C--8 ΪgWZ9t_#7Bc+ٱ88\C"AvGnWIg5)}c3dKy 9 jM=}[OqS ͍ɞJ=&8kz;1Q m="uv s}n}"݈S{Xjxj-/4ںwVeŌէ̶%תpsc{oN0U顃`Pu]T-n8v_~\hwb.GEwRRM9o1wT'jE{ [z/2%H7F-׃p4lLjigd8-nmql8}ڙi'3[/It^8_yo©4CTYyFrGHv≢/QSl_ýovbFjy9 ke]~Gӟ?/ӭR1E'0}~<ϯ4{E^r^?WV5GU,yꉔ~<UĆ)T$KUL@욘S?׏dL ;K5yNmХsǜ1/$aJZl̥QSiw-ɊGxs_ x0I5g|I]_;]w$( @g`eOC|tN*F%<g["s)s@#h*}"LnsPdn1Rx6>K`GXˑ&]/I֏w)eٟM0ռATΩ`)yVVU/YήxU_ld;y]aiI90Тv^PtրQy"gZpUnN*lЌ>8lm_ NH1A׆ r;AO=@ypvg/Єhf^Z lNP/()Ar/(Z(#ŖrjNAZ=Hk=5ڐQpZ)&AMIoHɐ ʱ-D Mqg%ƞ;d%lYisqprBe+r3OۊEQAG %C4y+%QՂFj(qFa7iveo|ITňF(hctsFeOGu!֘FpцLx(4 f=8ەFWgzlAh9mp/(8ųv8:=X8y88cmy[8oL\Vz]`+lmt>Cא~۵?ʼn<>lc[(0ܹ}ٛ"OS%<;x*F[h^ͺ_}cWw?EIswsMqEA9 6/(;{6q'ǮK>Y}{#@ȦDFx%243˚7Glgfisd/3`̲~ +E>WH]22Df]'26Uy(dU XfFRdn͙ͬ2d2og'/̜teiֲ##Ξi&-OX{̵]l(4b. jF.wZ9Vȥ~̓[< *7rUjF֙)1>$1J?u\Ȳ=郬^2~|`VOLcdƦI'[,b/|߾sbdb˗qvfXyGbɚKO _R׿:U 35hP@wHH B@oWEzcлG4V66 F٪՟ULI)yd,^@qEzJ'2[3RrG$e B(/姠yy;c`E &vsBZAxf¶GCW;FP yG}\ߛYdq7Yp[kjz.(Mh _2R^ZܩƴFd5dA_.wNz#oX1mA`Q6xܡ^}/re 5XcwaxՓ"DNfh[~oh $7rul8SgeSxRCn׽c jeU_ӼOu GE1S jxlc\qkd%?5_Ɛy<ޒ< +~S45/ g q(ոDֶCcݨeJBeṳ0SA"*R9?eO)"^=H9VqToT'j9;fTTiEO{Av+߇8k4#E*|IƸIhYFEiH5Ԫ7}HMg"HqJ鉴q̅J/jEEAZ`9]A %%SSyHs|AT> UߨEOWEP3oTq*_VXۗ*ʗ-ȏld$rċ9ݗ댕`m?SUePfGl k75VtcկQ3b,a@eL1EݝP :U]Xa^ˀZ]U{VLa_TX&\=ÓRSQn)BٱT>hxT. ?4L]g-o>ټi}a삞FX Bִ^^Wͤ x\e sސm〧"Vv:"tBZ4i Է)cV׸hZ5AvP*Gh&[6T4h@!\%А 7 L41Fm*n{\fѢ!1FV iJl7h&h4!%'LS*1D3ާ2\fĄ8(}6S3L!P>fZN)SN IE0ϜbA5g#neP.3FhBs1]=FC*5^a1BUyj= =vPt69r_ IE#rkADbomC p0(}6*FEl p QA8\bʐĹ靓3R9ƨ ,+2 !Z[4e#\)8+FBYȒ"GAyMUďV ծ 3J~RqV4D!vͅ!bu uRM@$,-RʇW\~~4 olWjN롤n7wT[E[}?nq ŸH [k~ u푔>Kk9GmVCZ0R7Т)B#CОHB=k,r 턚PհRN1(2b :cPd~=g%?AueZLAdNP$'Rfk'NFh蒌`قj`fbśF3c~jx&sж2u2SsK6vei梅fQl1M&z;4`Ӟf1XC{9| Ʋ-_qV:}⫅[LN{,KvȚR;OCh:0R;sLu]! M1V3:4 O|ix_l˳r611MbCKYjز W7fn5hou1ͬzii:~=C6Q-BM~ jjJ:j}xBͮRW- 6RWݿ_^\?|ʁc.^xxXn߼=ܾۏj;ͻw%^Og78(roSt/8I*!k=wvc]^gShASU!!Fu:#T t*8r\:%>%AWhD8.x\}A- j]ф7= ϓ)hIkH%Z"VG6~xB~`o 'z.DDex:cpqqԋy ~ߧ|M4E#M\bWcp[ !M `#b|ȰQKf`3+WPO'%˼s{#L^M< hDZf8c }*^ I %c@멖U.mn٣" _UǵO=:9pŒy 7LӤr63B AـKCJ Y*s\WvZt GEqEŵ>gCj4dy)Iߟ. La)PR%hiK;> AXݏ|F$u^-VEAm ؖqO_F%V'}Y`=_Ri'uۊB&NRd`:^'6+/;?_f9\zonDMR{xZRB!E'%3]+yīc#ɐ ~y|Yç?_&/36{pӶP41ݪz)W`s=l&$cO!z&V&K}z~&aD0=?U'DNxS əS{fƠ5iwqx-Fsz,Q^!?;&ѣ%Tw >N[}?(5wGl&%4iMFL e멿SS?ӟ{8y&MsxQ3(."^ aﳈZ\LD ) ]Lg05|AbP#vŐ3V;dՙ@ B簁c-7cHC|j9pWH',ij- 2k U/5Ya(hdU 6$b$L}f֜4qݪb' 0;A`J-NNitv+Nh]VNN$KJ;I)%q]N;!8Xv|4:`\`Z, y XKD*HDE4ƣ$\=f~]i78c| [biLR`{%l/Te?n/d RrieP@#˝ĕ?+V곦4Žy)dzW%ZX~dM31KY?G endstream endobj 42 0 obj << /ProcSet [ /PDF /Text ] /Font << /F3 4 0 R /F5 5 0 R /F6 13 0 R /F8 14 0 R /F13 32 0 R >> /Pattern << /P1 43 0 R /P2 44 0 R /P3 45 0 R >> /ExtGState << /GS1 6 0 R /GS2 7 0 R /GS3 21 0 R /GS4 22 0 R >> /ColorSpace << /CS1 8 0 R /CS3 46 0 R /CS4 47 0 R >> >> endobj 43 0 obj << /Type /Pattern /PatternType 1 /Resources 72 0 R /Matrix [ 0.48 0 0 0.60001 -402.48 -1833.84 ] /PaintType 1 /TilingType 1 /BBox [ 0 0 8 8 ] /XStep 8 /YStep 8 /Length 89 /Filter /FlateDecode >> stream H2P0BCl^.}`cb^B^. 0Lrʇ+XI0`=}JJSy<]\@偼\vy endstream endobj 44 0 obj << /Type /Pattern /PatternType 1 /Resources 73 0 R /Matrix [ 0.48 0 0 0.60001 -402.48 -1833.84 ] /PaintType 1 /TilingType 1 /BBox [ 0 0 8 8 ] /XStep 8 /YStep 8 /Length 89 /Filter /FlateDecode >> stream H2P0BCl^.}`cb^B^. 0Lrʇ+XI0`=}JJSy<]\@偼\qn endstream endobj 45 0 obj << /Type /Pattern /PatternType 1 /Resources 74 0 R /Matrix [ 0.48 0 0 0.60001 -402.48 -1833.84 ] /PaintType 1 /TilingType 1 /BBox [ 0 0 8 8 ] /XStep 8 /YStep 8 /Length 86 /Filter /FlateDecode >> stream H2P0BCl^.}`cb^B^. 0Lrʇ+XI0`=}JJSy<]]¼\@偼\h endstream endobj 46 0 obj [ /CalGray << /Gamma 1.8 /WhitePoint [ 0.951 1 1.089 ] >> ] endobj 47 0 obj [ /Pattern /DeviceCMYK ] endobj 48 0 obj << /Type /Page /Parent 151 0 R /Resources 50 0 R /Contents 49 0 R >> endobj 49 0 obj << /Length 8718 /Filter /FlateDecode >> stream HWn]G ?R^v iHw6m,gVd~DsF<:T^_8s#cGMJ߿r~_yx}eqW?23+Eod~l^bf84ܙa)*a̙TWyxw}M6l=ǣjR7 #ygRJCAp۩&TѺWH:2pU b>tPqK<5!FQHMQOgQ q:2ߤS_ٝiz=LD2==H#ZW{Dݩ<=nwf-]ۇ6G&!#E#Y %u8p݀fHLC8S7K [UU.rn]k>ag2%!F|:,?ZRo ӛO[G^P Ooߵ]9Ÿe7^7뫗 !>cC)go3F_x4Ow`]Yߝ|`>7ߚ_?-YKoס 7.Z %+aф[[RHi Kȓ 7I9-X=Ғ 1.@BO k`ّ& a!T!ɲIɢYG&.H'4)`>Pvkk>*ww0({ABpI-/IQvKMX3T߅^äqHSWɭt/{&! aruy̠H$.",J'4Cv.l9e?^^ӗ'Ms:0!B-jK=G1z}AB^C|Ĝ0ѵGFXDbWkqҟФrL} ) Uv*8Q^uLUb VMhXOyGBp&}y"0#S᱁M~@m%+pX%!]D[𝏈JY LMkBJ+ ?DVa "򡤸Qox-G %K$Ar2}UpAt`dy^_5:Hi#g,TљN#=!<#k&CUBҔŘuVo18Xb(Њǯ5yqg 4l{5$ETFD]ݾ+6RQx !$JYqAJ } |6@[ ז-[Y" #qAG|qXvɼDbULǭ %rfAO_ji;́TrlɬE(V10OdĴ;i]@("K C)$j u)<0~~thX6b4_L@F\_UQ2#ׂӅ-6 s:+dK{Fh*\hwD1U!nFhMIh 2iMdŲ ub(ɷA21l*Yp$8$x n3px%_nYj%o% Em'֖ȈD ڵ+uͅU#Բa_:qYtxurr:SK).l:el:HQйpjЩS^z(W[ӅNKGRSH=w(Χ bZWy5Rr/kGU[[nKjgvbH#\^yx)^MwMR[jͿE}2{6dw"}lid7ȝj[Z+_ ǜ=,*'QF e@ÉD-ĩj>VVqe8NrUt=xMȏp& ŗN`D7@hIFW!6#|gICΪ=OTMT" z7>mT6F&;2( ,E$pª")RDJdX ׻  v4(uBxp- ,8ە .kĕ+ ,L)8|׃A3+?9]$qo1C ؑŇOz*ORL:ukh#hX_/re᭶.EPae3EJ7*==Oc-#eeUnΝǁΣ'D wC&6i‘-/o8ڔWl SDJg4EA?ۣ@SRK: ?/bEӰåF@o)zdYnI5CE{X^"樓ƃpl[q=,"7 y9`:#B͗k|-(\~&gBUnWQ|7]}1pޗ!9\ǵ˷S(Sb̈́~.r:2PnjP.-cG,zBTw?с`(A@{|qo9a>¨~ź ]4(`SCM3C[Nx1&`ɏ7t]2hȻ#YJ拁V Ui2)Р[ ݘPula5߯;4I6]zj\Rֽ=Aw  ^wce [ q_:w }N7B!xHAz u{MMT !>ț68čM iԗ]ȵ[  mM]Lej>ɛ̩ I[VyxǭE;>oEL؄|{:mm&mWs(껚'lŕ1Qps7(ΥJ::538Q0~y:Iϯ r+D 7&9M#rB2y:?c&[v% z%j'Z7-QGhAcZgLјR,h׿5,gG?ԣ?ǿHJ HH -ƗA4qz̍85?"n ' #I?Y[!Phxl}=:5uX#c¤ZDPp~N6J//Hgy#۠HqbнYRÈ'Ci9Te|&h2 ݒ/׃AB!m [LX>EJ箆*T &6&=+ĒRydzFI;fŠJߋŐ:T%eJ| 4犆Kr"74e)ZFUh}2vTEøJX$&UhIp^H+6c=;t\u&WlwQ@HI;jvZF7D$}M?wwxm]R ޑ9qZkmrk;G<(׼>0i+,aɡ-\NBEJ5<'[YAVj PYEH(&nѕȭv8l+0VEAЪ6L մmC*L>2A3𠎗HP9Nޝ0rmͼ=Y}<BQ$٤*)׮Å9~D2c@J,JRi @,IkVEpZ)_Toc` r ֐]t`qnZ 08LL?UR0 Z<3>@څ5N/)0k*Ϟ*0Z)OEH8=b'x~ZH[PrQ? eG%!M"qM4!L0Mp7Ac{A$q|ۿY̲RfS4fPJV6e$~m}#FT܊}W1]'vb?GߠQ\#uGVZe|7^~8?ϓ|FWH:qԨ @;$s@t{^f |57};?n}H@68 _(G, ' v"*,ZɃbI `7Z"xPFi6L~b6x`1?_7Q`YL&/k!ʼxuڻ_8/w6&\T0 s[ mNR!Z,qp}%cpG/l2";Oe_Op}L-.Ő+ˑ)v؂sv|K9_n0pHr&$SaEHFpnR< e("-5_AB[n&})hQ8:E(RiiO)eFT)#^dE Hȡ0u_B 9Ei31|H$ZT+?tV*zOOX%͈n9,+3Rb%*͢$ǓLjX5p7PF ^lwmʋ.ͮ,֧JTLݥr. 1u VU"y`9D0RjHcK/QF|1'D`q) RFeiKJ& :qCB.tJ!:}Xtκ24$S֕P2#JKŧR`,$E;w{hsi"JҜEK#TP DnőBAϣRZV82 ƥ֑8 QIi/|7.0Cԩ mNPa8&{{퀳"}Cxa8ǗǤe O8~kJu(=DB aCޘkO/0Z>)8* )Ȋҋ.jiQ k |(M%]Ki9's &Yg d*1.@tnchZi:L+VȜJ2/JQ qۄlPmt@ |Vwm}ɕuK}cW2E,(im/=/x6Bo~ΗcSF$+BғtrȉP g&3F!.e0bR'4=iQ^Nk"iN4;y!2Uy6ð_ la;E}I!]IȣN[ JA, a}WhPԼIK@$ӏv̯%߯Jq1TS,(4h-aHŧTD5z:YU> /Pattern << /P4 52 0 R >> /ExtGState << /GS1 6 0 R /GS2 7 0 R /GS3 21 0 R /GS4 22 0 R >> /ColorSpace << /CS1 8 0 R /CS3 46 0 R /CS4 47 0 R >> >> endobj 51 0 obj << /Type /Font /Subtype /Type1 /Name /F19 /FirstChar 0 /LastChar 255 /Widths [ 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 278 278 355 556 556 889 667 191 333 333 389 584 278 333 278 278 556 556 556 556 556 556 556 556 556 556 278 278 584 584 584 556 1015 667 667 722 722 667 611 778 722 278 500 667 556 833 722 778 667 778 722 667 611 722 667 944 667 667 611 278 278 278 469 556 333 556 556 500 556 556 278 556 556 222 222 500 222 833 556 556 556 556 333 500 278 556 500 722 500 500 500 334 260 334 584 750 750 750 222 556 333 1000 556 556 333 1000 667 333 1000 750 750 750 750 222 222 333 333 350 556 1000 333 1000 500 333 944 750 750 667 278 333 556 556 556 556 260 556 333 737 370 556 584 333 737 552 400 549 333 333 333 576 537 278 333 333 365 556 834 834 834 611 667 667 667 667 667 667 1000 722 667 667 667 667 278 278 278 278 722 722 778 778 778 778 778 584 778 722 722 722 722 667 667 611 556 556 556 556 556 556 889 500 556 556 556 556 278 278 278 278 556 556 556 556 556 556 556 549 611 556 556 556 556 500 556 500 ] /Encoding 88 0 R /BaseFont /JDLMDN+Gen_Arial /FontDescriptor 83 0 R >> endobj 52 0 obj << /Type /Pattern /PatternType 1 /Resources 75 0 R /Matrix [ 0.72 0 0 0.72 -1446 -1858.2 ] /PaintType 1 /TilingType 1 /BBox [ 0 0 8 8 ] /XStep 8 /YStep 8 /Length 89 /Filter /FlateDecode >> stream H2P0BCl^.}`cb^B^. 0Lrʇ+XI0`=}JJSy<]\@偼\vy endstream endobj 53 0 obj << /Type /Page /Parent 57 0 R /Resources 55 0 R /Contents 54 0 R >> endobj 54 0 obj << /Length 5153 /Filter /FlateDecode >> stream HWQ6~_`5+R%[v{m H\CYmeeu~}CRuvWY[8曙W7?dL$F}՗+O2?vUeE{jXeSeg# RpV?:"NIWb\|]|)KPmYP\Ö6q2A*'_w嫱C+|vo9kOYSa=˚ug>33uUxHkهɰS͆qqc7*eS8j`JvE#q/W#L$4X7y1.yEЋVU-B ]u1s<ڮ7\O<7#vYW<lӵ{{Vv8U67S[J;c"3Xl]R#HMx8e]aFsFD.ߗM;,M'MIܠEdn߱d46PE4 |Ve*8:GZ jM =k"cҘC8@~NlbѴh@>9[D]l*v~1/ǯ' _L[l>ŖZ~<ĦrC|_vJj1q<=Tj4@X۸tvZ0FN^1 }mۓzƧw?3 `_kZݾ.ǎ'caJ)QW Phy\vxlpM{G5hZݣ]8vS%Q;M^O<끷*q:z';V됞a~EUJd 7Y1T!s"&(6 uN\3TeI&Pa,Or1+4)Jϲ/ Sf5=t\.P7?M{omNҴ,%H(%PUʘ3ʕ&*6Ȼjd~f]1bN<6C +-'^N}D uuA+#R0[Ku!q]Wn-95|u]z6؏Ϳ~pXa:JRz6E-S5wgN f+*WGoOF|:F$>?-μ8^c\zI8+T#v2\/ȥϢBBwu3Bwr) \"7vYk,l̸}jGZF8ieQ|.cIj8t6'e{[VLCӉ*s\aZjz`P*Ĩ'Lpe{Dq^av)4c~F _5h2wsr=nP4~]E~ؖv6$IrJ>^md\(^ދ.9;iѮ0lSu;88{: pc "k uݡB2`8!~=A;ݼh E{㺸MmAb&)0 ėw6ӊdg_B@o}dm U&L%~,ѥba)RTp=8 EJ8I@3j0Jy1Sp:3_K4!PDxJ w" u'foa`1%[h SB?c)x 3ܒ=XB+x r+Nxs9iIppNOpg SNIB.%=ktT-*P N)\Ta!pJKDlvK]u8ˀGcaBbng (6#k|'vK83T:Qm=zYF)R')<nan/)B2ܸ.JGGxɵ-6TѪoZ{2T]:j[ն2ڛ,fmj w k?>^.Oi/.mrˆR\[O0Q}.O KԵ0j 6g#%W8qJҵknA[oYt1AUV)%= Nbz[=!QWQ&ަ/s[I~<(; L,^c2e)=XBNa)5'C&Bqra+϶|),RXid_X)*R)T^H1u^JYHhAv3C3MQfوUs|6Ƿ r; o#y\)F^)0FӌC-7>[w?軉m䜉t,q*"lgWt)8LaTD!:zw9":㼉X{J|ʽm .5S$hQdyxwk[Eg/m@dV1~D2d:h"i?)`:VRjbD~(# 'OOXy Z(fFu7i7]&!UT7p|D ޭ\l}IkOjμ]0U{cZ s}kNqLFBNC͎OH~$&y4ʖis."*ja:9KHp ?pU"?Q ^3 c1q '"[k(]+`Db_BZ8_k` 3 q 9 ߯@6 -D_zV!'k#-!?hM5Ā9`٬Sސ"ag53|=G IwL1,C*JFB(RɒPOXOʜac2rO.N&\a*gp:-}guݦ*3$yh/dJuagmj5FV F.UIΫaȘ`Wڶ28f%mh!d [l%T\sD'GTsQQw`nDgBm"io18]8{|݇+w8TK2 nqlb?fE JXǯa__nr~ק??n^8?4/ endstream endobj 55 0 obj << /ProcSet [ /PDF /Text ] /Font << /F5 5 0 R /F6 13 0 R /F13 32 0 R >> /ExtGState << /GS2 7 0 R /GS3 21 0 R >> /ColorSpace << /CS1 8 0 R >> >> endobj 56 0 obj << /Type /Pages /Kids [ 9 0 R 151 0 R 57 0 R ] /Count 17 /MediaBox [ 0 0 595 842 ] >> endobj 57 0 obj << /Type /Pages /Kids [ 53 0 R 58 0 R 62 0 R 66 0 R 69 0 R 152 0 R ] /Count 6 /Parent 56 0 R >> endobj 58 0 obj << /Type /Page /Parent 57 0 R /Resources 60 0 R /Contents 59 0 R >> endobj 59 0 obj << /Length 6106 /Filter /FlateDecode >> stream HWKoG Ulg%9Ќm/dXć`/߬kBI~"Y$r~R,~CZ@7>%y _?.=?Sl5up4KS᷐b?3I'<)έM9S z|BԖZqet6t.iJd+yB%JTbW.T@Xi±Ǹ3Evy/֋>/X3-)u:eZb]pNDJNx]2^=+mֵ:-rt$DZ-1M&q%I4+DXbZ ̟ T4} d)}*R$'Nrr rӼu+5a}ꃊO-M@fNF|#} Bd:'f:VUiSf^ܹw%zzB30,}mx}s; ~h,0XaM).c j&B CP!wG(#a0e(0 6@I~-Mph~PmԠn Pߚ6m2EJw2 !f9B8B CH Gp0 !q2,sbh+7jd2lYeBnm" W U;ͦ gȥL8A(3 `X ]N2ԠWXBS.nmL`alܶ0ٲEV,[^K7Qުf&_ suq,Mf'ƖW[&[nVԭB?CbeY:FJD,Hpwe C R\:uLVB2]1tX])QـRF Fy` 6j/1 Bs)e Ji2DT=-E*X;H;R432bڡ-HFܰ+Rm@aWoI h 8꣋9Cr̙IьGI#-AI"9.w,w,,+rA ̔d${"DK"V#\br +Dƭ^2 fd/銑.*2a :~ w?p7Y6b>#^ gZdNf q2953rͻ7yH1 ON~ e`\Jb4f-amqgJE}wn>rR\A Kt{wÛOipVP5+E'bc,<2ob10a` ]5&tLI7K5Ԫx܃ɧjnx :6;ͥ]"مʙ4`.iT"? j|O}ct o^Uև !#2r#J:eax(cbv]awQ"]+@%1 p4r0Tn(3C2c0Tn(3CJuc)\+AZ*:Pʵ XDn5r-k\ @*?n%u(8B\p787xqǀ`G!8B\R@ROԯXԯXb#:B,uX~j#GpËLh]ZM^U6BС0P#d(u0r!ꕵX" LIrѷM md#RfŶP^T:B|u#oG>>H!1p`@p!p؎36!9{AKs0#aEG(BꉴFM9A /0Q'?qz''ѓϚr(M92l넑 _:$"8D`@!88BB#$ 8B#$88BB4T֡$✦i4' 3 pHzJa00\F'8Q T2$Pahʐ@*C T04Pe1.7THα()ODx#EBrP$S-ƨraI~WWbh&N-E* @>HC1@ifR ]bc gD w OD`z! Qh 66gIH1V,v$ḤV$1,0pc,c]bD Mu~0 p%Ty' T@8Ac"?|\m Vx,}. B75ߙJd%\t=5˩.шI,J0,{Of( +5 0h $$BβT XJ8@bn3$"hǶ#ڠUgLtLLKT<H8p 3Xj'6H0ٵ#_# ׮%.;B"Ʉdp)\MNMrQ1ZG.+c,غ*4al#jY<E{R)@v<$p)>ihWVj3~TH.CH#%q)NneƄ]ӅD {vULua$&Utkt{'޿kD354(.?5L:CЌ(=5dJ2jߠ('ko ]_dg2I "@0RX9޿2E03jlK BLyG-6lMdF5hd8eU#xtDh̤fG|#d;戳4# +> XdS:KW#(Zq HV;6|cVDGJپR,I:oÆ;凃9^XL҅{b`V&3$ʣu38Ha%̾VC)fGD@%ݮ {fdPM[6znZ7KtzrY;v~C{vX-vf0v7}:~:?GQ#9nŸ8PmlSb'as0wwwfy4_zggaPf*saኧG-] :ft,fvÝW3.vlw|A6ғ%FyxXO }E, 'XT C%oa[l[T Qt%PƔ&v>[OTXIF}n9@:ٌbrXб9xc1wJa1[?`c 7k[\صQ.yx^3+ASn%b øǻa,:˗Jqf%CtyqڐҷﬗYυ`Zh7<suL!R*򭊂1V%@`(> /ExtGState << /GS1 6 0 R /GS2 7 0 R >> /ColorSpace << /CS1 8 0 R /CS3 46 0 R >> >> endobj 61 0 obj << /Type /Font /Subtype /Type1 /Name /F4 /BaseFont /Helvetica-Bold >> endobj 62 0 obj << /Type /Page /Parent 57 0 R /Resources 64 0 R /Contents 63 0 R >> endobj 63 0 obj << /Length 12273 /Filter /FlateDecode >> stream HW[oT~G?ȬC߻ϣ ,+$} NƐ,ե/g3F<ˏǏ>?~dd9ɖ9i{N_yL_oyqӇ0m:G϶O7`h<>TNkr|Gte|gyOk2[GWE0({sbpr_%'8mbz^%qJW}+Y8{'KxLaK+S=p,0^)&K=th1yqR*C+W"Hĝ僈 zțD۪AO yy @ӘĻNe&Mx?M$Xx83*3Džq$/nq ,,ʛ0p;ao(m2wܝP)Ta٭S{;=8h6tUo,|.C &TW %S)F{52"IW[ܛn+v!d0s>g*{6!Vs|<dj _nt1#ld[*#.H%]NR.$wvJJUח sG3ʮUv]qZ=rVFQw#k* nB DZ$7U'Xzq(eJsacy2.:0y"~5Lb=HŒWlʃuCawn[I(P2:QpaȞkx!TD4JUdːh ~ÓGac+\7UFec5+i8Ҧ{TL5؁xE-B!ٳ/n()X$`\go/ĉ% =Y?fWB8oN_~25 O9GHD/$jA3]$&4ItCa rB]p*okzlJ~VI-!U4yvsdx=ɰT׏$!prODOOd~&썋Zsh"zyr}>"U4N V44J~S4561Oe}8#8Sx>f8PUU=cPHTІClC$шDɾ_v=ݔd&gd*8>U1(~!u\ji҄/|u^W,0l_7Rw*Uj+XT7.3 HϣUD&5y*c7 VJX7lIhie<ˢ8=TJmXr9?Rxk,H%e|c0ndxϷ|x74T'T / >L?Xwƌ/ˋNe(s nu7I]JXXsd1=C@IF AcE,`G /`Q8idc x@ *S:+xGuDBPV2-2(T\ /A`ǯgɹg>'(,?Ρ Er<"؈y'\2Zb\$kLCK> @BU:in9!A2u4l{ܴC&X!3C>JXq';O}(&2ˉ`G6SU89-}Cݹ%zJ;SqWl"552Ǯ{KGOҼϝ(a֊CdyS&Q]}B7mc* Rj[jlk895nunpqғ_:o6\u:U=\ vSQˏ6a x ,5^UKjyN-5^UKjy弶ruoDidh{*qN<)0՞C#KÂ)w/M<Ƅ74<7y)^Sy HXŐ5!f/MacN2`~LxCVm!y oT}`rTO0ޯՌi>|ZqkHmmhhhr/oC:aij2亂mWQ9>rB]>uaVU 9"Îթ4$z P蒦F׌].5fr ^!)aiL G-|Mf )3D}c6cۿvָA-025uan-yr]_1DӢAsjeBSM_1j:"zzW 08C3sMa'Jyn )DK|0 gi*N[1/%x6^p0 Al َ >jRHD ڜF-۟0yCˑPf$گP呡0m)4@XU3iQFسb/82zJi=tN9 0a,;i)@!Ӣ5ltEA;\yKmU0a&DUgu&,JS 1dLd;^8CA-wnE4u B̴Q^E?MTO5xi2 g ڦU/(s?h%r~}J gA !)A?:6Z|μ,&t̹ŧH-x!z`Í?f[[ҧeZM3 d.AKjӐm٢+- V{qnlBvo7- -`%\WeEe܃@4{ś3ﷃ{l\} :[5Ԉ>o.z|-=h,`v(v]X;ǻAJۂ/4aޱ1[4:60f^f<aSP= hTKi\4M x43Sţq33 LC'H3kt[[6`Jlͫ$I g@h LknDBN*Oi_X;rUPzn?mt 4dznjEI$uH⊷]@QMmҊФ_xSu.n[Ckvkki5}o1<@cŎXJ;zI_ "%>O`C[ ,Q 6Ģv?xp=R_On~olq"B:E:ckdn0ڑр(\ L> ["V Nz]58up#D,䙺s $nC_~vB_?Q7|3}g0\O !ұ/&,$4`<tM̩ ?|d4.H >{͞LT(k64'0Do bOCnj-vi%' Z2G•$%anYHЗ\/8y2;I.#bdqvd:޽aЯ '#I+^{ɤ8D^<bБg.yzJeRa)C.|]FSdoA'yL68 Bsٕ˭|/>}y\ڕR5fW#b3<:7so²z%!{䧱q V`ldŖI "^V`#wd%w)bDi jǘր토UP]02Fo"cG;y6/w, {N`LûKN6$XMu6}{J{a7!4+(FAi 9Ɲ<{1˱`J.6ӄ06sD52@C>9`#`odC Ev2&e.!Pr`x m>RAdU;K `XuVYJ-3P[l㓨!ex!̏BݐaxDd ĉTE5ulSS5\ު8sqpp摱kl#z#al9fRU>.d"o%Kx9V2n;k!㇀WA.kȅBm,% Uk5C6|l%6aB 6vfsߦ YJ OM(督K;G &ôlcwRU_46nuۦ YJ&*|E~fp+ʐB2C%L^J=vCb)LV/C ;5nQ^뒒C +%tܲlm!~]!8v*`Ȅݱ %jԦ6PSv^^qWHmwkwګ3`p2T1T0hߠ:e‚YEǧ` ..0 J@FAH!o JeNsۂY-:RO|8DQO`SOR m5'uYO +@Z?jyR6^6L\4frGr~݁]5Wٶ']j`Q8@SJv.eމQ9NRDpbwa.9JS?{]ԡ%&'.iJ ڤ.%jHdj9>c MpT˃FH7ccl*ѕeb۷STW*k (( o 0׉mAl'\Gt&io_߼'+"/);9l6\򰽍f zvIØƻd,A;I։}mn~=v6n|`R6O4H`<ԖSݑ.Ǵ2mYUƉ\\N 3eR˔|u} L +#: _>i4 %c,iҶѝ@i6T6P' 4@[#1F\a}KȵK肩D0@p~,9yCC&{|8aR<΁هu^9/f.=rK8);ǜYn=XA@/nuJ,,qtS '`Ơr `x? 'Η~Ie]PM%bsߛXB͂ho8OË<BFnP]@?PV. ;xkSfy\(Ԛ ك1ώZix` ]RCD j.SA>>Gp5dW?G 3l]5O8Xw7+(x_vzUBo'dZ/ٝ^i ^mؚvzUb[iLw;&z6L@\yF"&G=<8rtAgIgYU|̄? Elq> 3_]2'SVSPD^puAtVovU`f1HHqi5|/yV*|:KiK.2" ȪU&bt:ds9 }d*Z]-Fk퍈^]~6dCo Fѹn.A5d zesa&R{=VKE9_EAg$W Ir ?CDx goCzqϕNF,ڐ .6PZvVvIHcFIoCrTH _D#y_~ߑfwR$ղ:]Y ʕ~Vwbc+PX VFPƘ6vgjzm=@c7M!FpN9!%kgl d=/Q$}0bfrє8eGV|a?{t:&q\RėVUa'4Iƺ9CL!p~ -U)ڍyfZ{/EJy|gIGk8Yduʡ};fMb<$BgqϩB1!0UT+>tw3<+IO 6\1f0u5*m>m 5ࣜ<='9g9* TW9ch@ ϫh+g9]ʹ6W9p?Y)b'ē<XpJM,d[l$FNlfIL49I49IiV9Mio內 ['9vͯr1UN,KT/pFNr{-r zU=vKq>LV(YdE1͊bn55 C@1-4+ Ȋ 2 0 +NBuO/ׄ}, H^^N2_m qEHx[3rg{O7}au -OBA}sk`?Ը$8}gFlb&`k3˜_3rg{O7}aօr怽0VRCvLLu3]_TW0+鳺L;1+סIW0}E)*%'O}7=Q-"YKV?~=Z~Oι?z_>t?_}wbww.VJW[׷\;]rF|-9,O孠>&;&Wĺ؃9~jЯ()O"~~ WKQ=[ MݲZH8]u 5͸k8Hlc_dӨcOņfسBj6qn ~;W,NLdCƾ`XX'ћ NGR®XrZz" fDWXk3e$it*(IG1/[0蛣bFNtUn!: SSË#c0Ln֊98w԰Q"򥖝S@XYh TSzlدv.x5r2]&Ljƾ\U$X"R5s5+ '<߰!B5u<xә^9w;h$\`D퇧[ +*JYSΔ6gPs/֚`j8k̀<͜b'FF}@%PEd+brD6K)$*;=0[v7#8f33O_Qt9<7wԾ e@+o%.S}0fLO Uf K4Ƴ=}Ǩ7>׈.grKH_zK 0E?J endstream endobj 64 0 obj << /ProcSet [ /PDF /Text ] /Font << /F4 61 0 R /F5 5 0 R /F20 65 0 R >> /ExtGState << /GS1 6 0 R /GS2 7 0 R >> /ColorSpace << /CS1 8 0 R /CS3 46 0 R >> >> endobj 65 0 obj << /Type /Font /Subtype /Type1 /Name /F20 /Encoding 89 0 R /BaseFont /Helvetica-Bold >> endobj 66 0 obj << /Type /Page /Parent 57 0 R /Resources 68 0 R /Contents 67 0 R >> endobj 67 0 obj << /Length 8627 /Filter /FlateDecode >> stream HWmo7n*'v8qI?V|z rWrbpfKt~&4I/LԼz+b(?]Iv;?xe4i"w; yt* ]&$7Lr0ӛYż ٧>)~ZX .<ۨdO/7#W #A}52o|vv|۰ o?~Y|7anl E~]55Γfn,lj; XtAa϶ͮٳr'GOV|:H3DZ/n(Hfk+g`*~̻> h4f&gO!o(uJ婸ՙUӰ&9^sOdD$o8Lˌ-fJ/b'B@ыAG@A~!ؔ‘7]P:g|kV7'%q@ر)frLl~v%=@)W;~n `M0=JB %SHd~S/z]392zB8Cczfln3*_gTIٷz7&^wWժ~\69eP%>͗-;T|ќr(bT#bt8h$FG@ʣeRE~U' Zi>Ss%F5%ў+M'F{gQHe-b7'4-xHíC=-ڳrȕIi=ֵ:U`S)#DOk [jq}QeY c)VvX]e>jsϮU D{LM4kC-h_:sqcS bVnE0y;5f~䗩'op7z; دә=UbbO5ufϨޣhs2'Ua7C 0cgm &&))PQi.yBG0)U`*_Pӂx's/63<,)$WNB>Gd-XoUWsԭ So?Qa4<o_i,^ 4-:nIZ]^sXM)5=-F>Vk0Pa@n= ~PHe8[ÅuC.R'e)`xU4$BS,ؤiBG6I |V2g-zZqcjOsE57F:ʈxl754-Ѣ $)(V@‘ !{1@`ŋ?ƪԃy2|,F`gk^Ueɑc]b9X(&].1d0v>cc}N.ƅ9djF9pZzȇ.بmjCuylyB\ V!~C](5ZK.`&F-"N-6$=,u%F3h45=6>th1T"[IKqPGCZkԢkaAudo2Bs :,,ױ=O=B#ٶrΖ$DQZs24@fu.M%ԅCzr@V!Uh1\\ n5vsd42{%X I "aL9N(/CCΫeű 63q`f3U'"_$6uN>"2'V}}u;q8ՉXinKdbzvߕ&pӱ $#"PmӁv֥JˆA녲m,+jaFfg]9DVV-gG2=>".B Gh#))l#OMAơ hCޒÄmρs!Q:յEL\*ޒBݏ,$0bx s} }1)Uz10鐲Up 5HouԀLhjSjCA]jO`9+Ussc8+ 2U;&<k;#8QfA81*5 2%A[?û!5~kV~$+eto^ogP1CgW @+F]Q1T jm &srsi;peݮ63->hG$ʝ&.m96.< BݰS/[4 R6zw=#>-ޖ1kX.59OEI}Xu.i iaPC xl1a+rSv,OLi[E8&د9ӀޢKqo?.WáEBHyFqm0n 2eMڕEI.<I'fQ)%2k w!7 K=?5%4n%28iYHeW}ON-X_5?}yB.d.q~i'>}ᗲ{ Igv4x?x—_ұ#73*XX=Q>r0R;RvM~ZUy-ĵf ;1 wj%&rsm@WX3g}0!*fB4(WJIDR]4 -Y(\ёrs61zGcɕՙnϿaoIqDp,p?"9q. :>8EڀLH=U` T$bⲬ"$m U ډ,K XNyMb=lq f0c.X$&"B`2E\S5@~PFCKpxݫYCW@wYIpB *0`{@rlΒM2?"( &X?;!#?[@*Q@;JV5̣xV00e5LjjRK ̧Wwgo^!sjH{~O[xSv/Yr]:O?PȣѝD#{! m>HB-k ve<`@Z8껼 IDIxsyftl ,GF⽼6EuvaB]4!knt B0Ѭ)2ąx&X50̓ -V+&xhCo L&eռil疉);f@O q$ʫYM %d&vY d d}2 ?_9z~CXy"يɵd.gj]K}kh{;<}}V2Xߢ[ړ +&vVcڳR _ӦΧ2~~L9~,{ Eق!+_BF6c3+/A+Lx(<CbחݹgOh}Gtp^vsw~_hsV\nY8W0画<"Z9; y/؃ь<bk(f.L^mL)xMAp&>٥0{LQ7Xp#ЬxQawecTv,pTPVny(^+$;Od0q ( 5V|6h-+v XY`YUJ>>?6z4:o2VFHi;${f2 )5 g[RMԡ+hG& 𨇇& fQk zZai^_>  4?'%t`fگL,|y1|tDz7=u_H)DJTT<?H2qcs?r޾)|TILhQCwTOU*wF+L$s<<|~ZO; ݉@~gV@nɁ)Yi(xT'N !h CRt%R %V:ٺkzg-!yc /-0^,z4ߝ/*=KC5.NSn zŹϋZ<-w>_XK{lTD0tIIO!>889mŲ.J|ϒO 9+hj*A=3.I'/vq-_ FLg !{ -DMh{/6yoP%>7 >[=Y6&wϷ8M;nYQ zݲ׫W'%|gmϗ|͂C9g (rȆZ9mg'8No/F>di(ӖS'reኄB̭)bJVa7hO>mPO#Vnx_. q04o26Pc(ڋ H$P^D.CӯiPlvǏ&z.XlKA'3mZY`Xp>>.quǦo az_iИ;vW Ě3 [19ٴFKHM"\#;RyPt0)^m/uAN],^;y8һ~^T@29VKm?@[Wl\u:=nH# 3fOEw [8zG,ZgsP>f^ lBI6HߔYyϣ%V(N!lW S8@mQ{C8*DP⣌c8kh}ɐO̠񍃏!'Qb0 OvڿdȬ{#S@8uֽs?52՗1& nx*,i ,8.R<)3<`Ac6G%8a&T2&ϳ!Kw~Gwk9U EE` VFL^uES~U u,+6X(?hգ8b\}T~=?-Rng|뽜o8am<7fT1V<5(٨6]v2@2ӵw]g}YLFM aB;.zZ:8?"{ 6*ʃ7ԢR4P፷ eF8: jRqt~J`#M0@fD<yoB| z烌Y;(oeR<,[0~yb(Z2x콮ץ&iyO,E5*Y "C RIfd8ϚYaMVPhFdz!~i.T:%[.E^ tEOȡ({#'9&[Lj4oUr&s;W> /ExtGState << /GS1 6 0 R /GS2 7 0 R >> /ColorSpace << /CS1 8 0 R /CS3 46 0 R >> >> endobj 69 0 obj << /Type /Page /Parent 57 0 R /Resources 71 0 R /Contents 70 0 R >> endobj 70 0 obj << /Length 889 /Filter /FlateDecode >> stream HVKo@GPJ}:b'N]9c@uB!b^vݙoyӓ ?Z`@öߢxIa} W. bSK5#R'jJz8}:3RT:RWԺAI,w2E(7ݑ?UnSc9*ÐOX|Paev [pF> /ExtGState << /GS2 7 0 R >> /ColorSpace << /CS1 8 0 R >> >> endobj 72 0 obj << /ProcSet [ /PDF /ImageB ] /ExtGState << /GS3 21 0 R >> >> endobj 73 0 obj << /ProcSet [ /PDF /ImageB ] /ExtGState << /GS3 21 0 R >> >> endobj 74 0 obj << /ProcSet [ /PDF /ImageB ] /ExtGState << /GS3 21 0 R >> >> endobj 75 0 obj << /ProcSet [ /PDF /ImageB ] /ExtGState << /GS3 21 0 R >> >> endobj 76 1 obj << /S /GoTo /D [ 92 0 R /Fit ] >> endobj 77 0 obj << /Type /FontDescriptor /Ascent 0 /CapHeight 0 /Descent 0 /Flags 4 /FontBBox [ -41 -243 997 929 ] /FontName /JDKMJG+Arial.Bold074.313 /ItalicAngle 0 /StemV 0 /CharSet (/G77/G87/G97/G107/G117/G48/G68/G78/G88/G98/G108/G49/G69/G79/G99/G109/G50\ /G119/G70/G80/G90/G100/G110/G179/G41/G40/G71/G101/G111/G72/G82/G102/G112\ /G122/G73/G83/G103/G54/G74/G84/G104/G114/G45/G65/G75/G85/G105/G115/G46/G\ 56/G66/G76/G86/G106/G116/G47/G67) /FontFile3 78 0 R >> endobj 78 0 obj << /Filter /FlateDecode /Length 5751 /Subtype /Type1C >> stream HdSkTSW U^ s >QDA F 2;R-- BQbb$M--#*Y:Kcls?]w}s{#CJ[M-ߣj(0lPɥQ(Rw2߽=];}{>wOz`h"X/dͼߪUbzwo@ML4^4BTiA!Ie ut슷S3u]ETpMM>?kkuƩTZiT,@jNTjN4jB9Sj8h&!"8u!F W2Nd$8U$$ 2SEq(Dq 9sj91drN N \)RɩZIh8J[_Pwn+i3=.N)gFf.sl/Z|&TԼIT:oR^9QvtU7dCW%tu#աftEQ>BP=:rWtGFtբt}ΡVtuCt@P UcȂyɸ*y~F|4 }~/ SR"?QhF#OґuSLuL~;Ϡz;~"NL  pLLk~mk^1D"Y(pu`-|^D--`Aˢ`^3) 5/$r'RA!Øy4PؒK 0@o/gް6z 똺evqngCax,A"^[<1c>jHb-yn(_I$% Փ$b-f[<@ `e!.`"xb(?PbĂPtB:X8T64! |l9F8|?~OXЅCLNJCHWJ%GjԲMSgˬ%+CjfkS>m-0X K]l9ߜ[-Z&T f[DwF{Ť$o†-LxϘax.cj'mie޿?mXk`R՗%˙'p8iwKLMnl0-0 l4m^v,:2:)pwQAYaE1&ip4vYoZWn7g%g%!,{ g+qE;x@H& 6J\ERLmp=g؛67a{Cw2b $dml֮Ch#pYo֚)=|[.$5!2_$-Z߽Kۓ!vqʶ9̪2.%l[{4e-КP*r<3 ;M 7 ٿfv _$6dZ - McqY g96Ϛu":P</N%J׵e2J4vmxk(q:GYki[hi):B;bH8y?x${Նw=2y=,TR'B7Ca!f=~Fpo卒+ lkmMO2 vZڹiy"ޠe kҒoΞ&[lkaKLýGrqղ!&Zjp ad Btմ5ZRfVТ?QqlQ , y꘸`& +{޲Y1!  xgu$ZR 8%x78ӄ9#M9wIm r\%=CҜʥA 1 3ec08ty/ ]Y'V.^k+RI,\1gbUMttqB~M.4|P'm7j,[v4_})~C+X(CJ^V]EADAQĈRBe% !bVTԶ&J#DF#F DXW"eK-2jq{mޝwstI"U|ѦBpSKD9ɧn1)ZE .q-!en룺#Z=: N5cs-e>̣l 6y`fS(k[[R[\U1KgM^{ /„۰4Rk*ũ%ᅻY, `|P_'Be}]S32<}ͬM,VP 1"Z oR"ik$]q9F]5s+ 5{HedؗK-zE58;Pio۟uw&ˉTA<$[^nnA iPy#݉D]5oWA`nt }*-If҉TX +&w"AT}#؀^){I;OL9|삸|tm6(<4u"A) uRЧ[&.}\wd`]˝ƒvtfYEq1CIt!S2[e(h=s)[캀j|eSspyjH˵ZsSAaWljzx&c7*<0*o>*404>1F <˯5'iuL7:1wMQ`q[[-֊iх|Ƌ~Wz1IΦ H{ E=ÓLꡦ}PRӦ~V=yVjQu3MY7ج=Y_B&&!+j3we)ٲ4&EY{dןiT +ktQ%}7#5]掿j%,c0x0m]". UiCZ1ד<:s9[tQlɣo5.rx'u*2鸰_OX e۔V~TyX,<M'GL庆p^Xgր]ިT.-k iHѱu 2mJI:7Ct|EG;;Ԁ.NV31JD[F|hCbctU8"'AB'b샟ˇ#XI_hmmS(G#gF0MRXLgesbf>bȴ\SfQRiVeg=FUYՅpp^ri۞eS:IDM#΁ƣ*X,P]m(\*tS;X%$S783]N!;ǖ%9R8.&ӯs p.Wz 1AsK?0S"yj[_E11pߏV ̔ XՙDvCglg{>m8WP-+ė @VMc$Z c|yo ]4v紧Xy!Xd01)8y5u hِ@gRbmRPd@Ir9q]γ&". ;EU*%iDTDxcbM{\lȮԶr̘Ěd(2db(UD yJ}\!H҃Tֽǭtʭ,c.Ԋcact~dk#SQO{B7"nBM'e+Lpזa] zyIt%~m]#_ޢoQCep7"tAR8sDґ/W _)֠/KDXnr pv%`7(fZB/ކpkɁ)'% )( óze|t#g\9M%E}{:kVKޅ`~8 Tv:W(M|>33h-N<'ƈ'_lFk,#u9zEK\<Ox0yk!!ɿ-@vY@iUjZD8zLEejBU}OCv;/mI+UQ'qxM+ 3Q2<Ϙ7CcZCXimc= ,R+L=f^kηۊ{@ekO.cp>`` Mς0#v^La7:oTe_g,\9V/e:I_wvSgN{M08k,=fH S'0~\0Su3Ajb#x4f6I{#Sԃ|x (lo-BkG?X_5S_?"5䙴LŎj1Pk :Rm=*Pʔ ;\pj-5jcMjuB_Ԓlzا.+)Q!)ۅs'Cꆺg'a =EZPJ4fՉ, n~\ jiU؁M έҾSsemu endstream endobj 79 0 obj << /Type /FontDescriptor /Ascent 0 /CapHeight 0 /Descent 0 /Flags 4 /FontBBox [ -46 -216 997 888 ] /FontName /JDKMJI+Arial074.313 /ItalicAngle 0 /StemV 0 /CharSet (/G97/G48/G78/G49/G99/G109/G50/G119/G80/G120/G51/G101/G111/G190/G52/G82/G\ 102/G53/G83/G34/G54/G114/G55/G65/G105/G46/G56/G66/G116/G47/G57) /FontFile3 80 0 R >> endobj 80 0 obj << /Filter /FlateDecode /Length 4010 /Subtype /Type1C >> stream HTU T yL屬k@Q< rx!`0hp")iպtYY@]1F"W-FPCe}ܐ ӞΜ{ߝ9,IOPN0LHǹlZ?a^:/5s|%ZXiO~_=QŬ8E޾KПdkɌTyPrQ1,%ccIQd,)$EX2 HR*b@fLdAĤTBHHI)bV %̊&dt4GQ2R*S̻2q,TL yh.+)*̕޽ZXA!%QhYLlB⇙l6NsjYw| ~>48> A38 (hu 8~ @58 BXXVll}#&xZ[EآCB:%^{My˼??  Bgv'䴾B(pl]\XU_ypO?l+|z@T1si=%r{07'3(xP.&, Lݽ~$uoi\VS'eX3Cqa )F,ˆ*yS'DPSx=hN!=':ǔb;p_9 WMbZNұI}>J)m׫u4ҔWDǃcߎv`}}H6o=|:^OB1hs8**8VقiT2:`SS,!AA}2Z!q̃U9D8+f$.fT]nau Ī3V}U{!=CNGT6"זe ]J?Vl up`76doU{t:ʭtf9Ru.m}3Nĝ]ǔl|h+ ;٤7Su>uG"e_bYV%'AR[P>}?q!S3!7R\\+tGNj. WM c'^q(uK!1;C9;/c{r:R>`Ap_C E"?_yBL?m/hgv&J*g@=4޴a/ _;MG)bӒ6u9zL"pxWA~5u dv('Luny2{-ܨP9V^;L?j|ϔ;Ճz0c5-weec٦DBC3C|IG!E Z_A1ՠ!ZaoÈGpc9\<XWmnCV[sc =}p:b4\L*v&anJ9hbǮ]ouT [)"FTsA.5r'ѠѬQԹpa[_MF6X۬mgζ|}bi qh}C^)Pi{hI^N0V9=d[?.?w3': Q 2k* Y&Wbʵ;䅟q$%j_־;Ry+&!6"*Ŕr2vW–=O#10?. >{gUl"sCVoPw56vYCxAkF)DמfI6)̨! ?E r 8j.\';&f[Ct?gaOC`? y\>δ& k]|Jy*z(u@NP=`R89%wG)JsVբjm(UbXi[0 n[k5v\!&urL}#;.!V)Ut0_5*|anIl:_b7:/{ ~yt[niW!|%텯7fe5P8"O8Ʃoy}<|+KjO,=!`a+LIP'()kΣNg?=Q?lɄ=Q]rkL>%' oW2DwM+|G-8P\ab$IMlIZtjr_.h38\-CS`uN̅zr̭좤ݭw2JCvr0ju\)Ô~C4wUzn:TQ6fZa s;VS *!-_}|_)rˏ~ǂ5 D눇o>YqPOzni/qfofh/WxQCyS( 3swULJ,50%f sv[]& ;xoWM:E*CF]Q4\QYs; L8Yk  Ho~;KpH1 ,rgbpo9:.6!;іF^X zpJv(lZsS%gN:9ˍvBkԛIUU7k% #7Z483~RV)/ȣiY[_h 9GJ&R ol85&)=_"^c0i^I0گ/0DpP`x"惯`W}b endstream endobj 81 0 obj << /Type /FontDescriptor /Ascent 0 /CapHeight 0 /Descent 0 /Flags 4 /FontBBox [ -46 -217 997 888 ] /FontName /JDLEGL+Arial083.313 /ItalicAngle 0 /StemV 0 /CharSet (/G97/G107/G117/G108/G118/G49/G69/G99/G109/G119/G50/G100/G110/G51/G71/G10\ 1/G111/G32/G52/G121/G82/G102/G112/G53/G73/G83/G54/G104/G114/G45/G55/G105\ /G115/G46/G66/G106/G116/G47) /FontFile3 82 0 R >> endobj 82 0 obj << /Filter /FlateDecode /Length 4185 /Subtype /Type1C >> stream HTT PSW΁<.V.EJU$$xy (y#[ci ]-("AA$ WEjQǺ=^;;w3݈X+"xd8m\uw~~ ͦtꭆ 6kͲf4? ,\¬bJ&蘩5}lqpruyFHbRg觟_rtq& ܷQ@EB:..TׅsW \\*<#<.)8;R5 \GґOTF'H''*u"Ŋ EΡɮINMKrHʖ+2,E"%g%' ,[KjeyH-$ВeXh@8Ԡ @ 89P߀JP JkPY *7pjPA PbwpfGF[K[Gфڧ`ƁHz>20Yf"4)6-Z䳥K31thYղ7ff&Ouٌ5E-Z۲靋l446S (ԏ aeV  PY1]f`@{=fsM?̌K=DRCd}28}Dxtj=l -p1regslptpdz ^ෲoFR#(+EY1XdTGBM9j{!hH($f:6! 8B| [[85]?#=' 3^?j|ܲGhϨt.@-WI$Gkв⋓2jf;6v ~32!SB*CŦĤdMiY YWL+cѭXk`[,K#Ȍټ i۱ Gl<bI52_v_`#+f͉V [5'we@ENHW,Ca/SۛIm6Vw_jXpÏ_~KD 7/UFIP$*D$vs9/LhBC֧j+hzD,G)DhOew 1n,ĕMDShތc!4-6xKӡDF;5O!_a,FƋ?88-ƴ~θOzq0H(+6ke&̽YPم6o{u9m4'֗`\Ῑ#MYwS4h۰ 'zc=]DV윤:Wzh_p!p}y8ezܴ>val Z(2Aü'p &&ip ܈Cf04}Ð9-T/ f峲kAv7&m↼kրqw;e؎>>}Ҥش =n,됑ց}'<>{U=-#ml3(^PB]]HB/-e_e}XON|~kS.QejrB{E%f"1w[k%9p^Q}JQq"T^Cyp`I7m_ǜUVk.6w`.->s#n( ԷڿIf6yTK}xFjڎ;r/MbM)~#--a͢ =`x:3٥#Ɔ{)AZVF_ "xkERg#D6۹1Ԉr b@0 iHukq<8o"^.H[ [*kʣڒձ2]bᅾH;pAC"A5`,1 k@eS jY"@(,Xť3cZ?|mo;3};w.3x= 1,}etst (d wnzS^ƚZAmP]Vg/5`y 6:NXlǎR +KeWsG=a>iWEnHݩjQ.Ȅe@an.`碫bgr '8Vv;YwaDBAHNr$8 ݯHL --hk]&-T:LZeƵB88~^Ko"RV^l{< (_:c#SsD ɏɳ{fCLkpuȝy:^kTMM+B u!p]20ֱ̆WthZ ?y5"o&#ﲟ;gXWo~7c4/ 3x-?B2~۸UO@l5-+W2@TO_"]m^R KDNs!݂ nS8/>4M/67='3f  )\Hh٬2LjfgK!- JN(xAL7`^t.x"r)ӲJ=Vc/G/+R2X<p=X&(,I,g!3 PwDW´i(^x8ytP4$4mKLIy|d2%"-ٗMHNll j `og8/-7 vP` As֥l+ŗOS v0.XKUs8 ֳo/ SVPoh&A*+ZO+2c߀wPoW=;Fl\l},(o:)/ќїs? tq4ڞ e4=1%Kܑsh)n;5]، _ʒ*v#=#͘7PzJ٤n3# SN<>fo] wIq(l-_pq'l+_NJ,'إ0\~G '$EnKa8#]dh%%Cׅܻtɫm 5l%[N5jYuVQTQw0[V.69 -|*<U@@rd۟^Õ\GQ`B*%exjo,6 endstream endobj 83 0 obj << /Type /FontDescriptor /Ascent 0 /CapHeight 0 /Descent 0 /Flags 4 /FontBBox [ 0 -200 1000 1000 ] /FontName /JDLMDN+Gen_Arial /ItalicAngle 0 /StemV 0 /CharSet (/MT111/MT83/MT103/MT112/MT104/MT105/MT76/MT114/MT67/MT97/MT115/MT107/MT9\ 8/MT116/MT69/MT99/MT108/MT117/MT100/MT109/MT101/MT32/MT110/MT82/MT102) /FontFile3 84 0 R >> endobj 84 0 obj << /Filter /FlateDecode /Length 2684 /Subtype /Type1C >> stream HDSip,}d*6iӖa4LIpk[úoV-Ӓ|_#xhqRit*Yg+twg 7sKǔ«U|/";I;C. o(?ى3j[ڿER:W?.d `EU١DW* V:\CtQ^@_#Ckn^Zh3 >U .Rnc@~hr@}P y ~݀nBÐ Btꇆ ;f0 6c'Ϙc܅N6hbۿ7okZ.' Zs^ v(v_O?zs)Z{YG>4n r5?2$Q0*ꐪBފ*mx#zr7&#kޱIl"~Wϊn{ʶPۮESNQY EU+ZB)vmЈ?k͔$iUH B![!zoiA\7(L)'Sey$v H%ד`>1džF!;l⃹͑UG\7Fቮу4BnuΌ+:[vLӁH ZD&zZ!mr!oy0u_hN ƀ戉:NAm.tYqXeL(w#7%+4&w3&LHaIbPUC 6>\9Cp/#bwڰNH_6&'T֟g=+bEA3rEF W4yQxu_"+% vp ̥2as, o؄,>Dkv)(0Lb=MQIb4Rpz?.`Ոgf3چE v,%Ɤgrr#cI1ňѫM,jtqN{j"T̚o,%SGO0pzx %zIQgBnX{?'woU+MYRb ٱ_f oȫSW"ǫwZ0ު&b_ &HI?܌s͊v[U:Ui&B!}$?aylS % sYd&K*{7u󲌶T!-rFqNNi'aK\!^ L=/%:3mBe#Ԙl4tAG S,-ο_fnmq[>m>daM&lx 4UHآUO&K9OnӋwEl>z>Q::*ߤ8>'Oh?b'v0fso`J)/یcYtfN3uY"o <=Ca~f;㵷>͡M 7=5Tm᭮ =" 7K\ Ott0e5{K.ûpc>?;>LLSԼ]Z0/kxPh $y>es( p{z94o\jCܱ{n!R(( rsD0FAhx41i$%t`ұ9FRw1xIJUtJӰ}sj@Ȕ[IuHeM/*T̛"klK;x1OX*4ʿ-)ig"(v/$t~<>z„+PIb`]}NHO ļPwݸk7*q%bI?mL Aa@NWS:HcpE#G#b){6ˈ.J Wo8.T& _M7|Z}dfk%؅1X&֨ ț!j/=?~an endstream endobj 85 0 obj << /Type /Encoding /Differences [ 0 /grave /acute /circumflex /tilde /macron /breve /dotaccent /dieresis /ring /cedilla /hungarumlaut /ogonek /caron /dotlessi 39 /quotesingle 96 /grave 127 /bullet /bullet /bullet /quotesinglbase /florin /quotedblbase /ellipsis /dagger /daggerdbl /circumflex /perthousand /Scaron /guilsinglleft /OE /bullet /bullet /bullet /bullet /quoteleft /quoteright /quotedblleft /quotedblright /bullet /endash /emdash /tilde /trademark /scaron /guilsinglright /oe /bullet /bullet /Ydieresis /space 164 /currency 166 /brokenbar 168 /dieresis /copyright /ordfeminine 172 /logicalnot /hyphen /registered /macron /degree /plusminus /twosuperior /threesuperior /acute /mu 183 /periodcentered /cedilla /onesuperior /ordmasculine 188 /onequarter /onehalf /threequarters 192 /Agrave /Aacute /Acircumflex /Atilde /Adieresis /Aring /AE /Ccedilla /Egrave /Eacute /Ecircumflex /Edieresis /Igrave /Iacute /Icircumflex /Idieresis /Eth /Ntilde /Ograve /Oacute /Ocircumflex /Otilde /Odieresis /multiply /Oslash /Ugrave /Uacute /Ucircumflex /Udieresis /Yacute /Thorn /germandbls /agrave /aacute /acircumflex /atilde /adieresis /aring /ae /ccedilla /egrave /eacute /ecircumflex /edieresis /igrave /iacute /icircumflex /idieresis /eth /ntilde /ograve /oacute /ocircumflex /otilde /odieresis /divide /oslash /ugrave /uacute /ucircumflex /udieresis /yacute /thorn /ydieresis ] >> endobj 86 0 obj << /Type /Encoding /Differences [ 0 /grave /acute /circumflex /tilde /macron /breve /dotaccent /dieresis /ring /cedilla /hungarumlaut /ogonek /caron /dotlessi 39 /quotesingle 96 /grave 127 /bullet /bullet /bullet /quotesinglbase /florin /quotedblbase /ellipsis /dagger /daggerdbl /bullet /perthousand /Scaron /guilsinglleft /OE /bullet /bullet /bullet /bullet /quoteleft /quoteright /quotedblleft /quotedblright /bullet /endash /emdash /bullet /trademark /scaron /guilsinglright /oe /bullet /bullet /Ydieresis /space 164 /currency 166 /brokenbar 168 /dieresis /copyright /ordfeminine 172 /logicalnot /hyphen /registered /macron /degree /plusminus /twosuperior /threesuperior /acute /mu 183 /periodcentered /cedilla /onesuperior /ordmasculine 188 /onequarter /onehalf /threequarters 192 /Agrave /Aacute /Acircumflex /Atilde /Adieresis /Aring /AE /Ccedilla /Egrave /Eacute /Ecircumflex /Edieresis /Igrave /Iacute /Icircumflex /Idieresis /Eth /Ntilde /Ograve /Oacute /Ocircumflex /Otilde /Odieresis /multiply /Oslash /Ugrave /Uacute /Ucircumflex /Udieresis /Yacute /Thorn /germandbls /agrave /aacute /acircumflex /atilde /adieresis /aring /ae /ccedilla /egrave /eacute /ecircumflex /edieresis /igrave /iacute /icircumflex /idieresis /eth /ntilde /ograve /oacute /ocircumflex /otilde /odieresis /divide /oslash /ugrave /uacute /ucircumflex /udieresis /yacute /thorn /ydieresis ] >> endobj 87 0 obj << /Type /Encoding /Differences [ 9 /G9 10 /G10 13 /G13 127 /G127 128 /G128 ] >> endobj 88 0 obj << /Type /Encoding /Differences [ 0 /MT0 9 /MT9 10 /MT10 13 /MT13 127 /MT127 128 /MT128 ] >> endobj 89 0 obj << /Type /Encoding /Differences [ 0 /grave /acute /circumflex /tilde /macron /breve /dotaccent /dieresis /ring /cedilla /hungarumlaut /ogonek /caron /dotlessi /fi /fl /Lslash /lslash /Zcaron /zcaron /minus 39 /quotesingle 96 /grave 130 /quotesinglbase /florin /quotedblbase /ellipsis /dagger /daggerdbl /circumflex /perthousand /Scaron /guilsinglleft /OE 145 /quoteleft /quoteright /quotedblleft /quotedblright /bullet /endash /emdash /tilde /trademark /scaron /guilsinglright /oe 159 /Ydieresis 164 /currency 166 /brokenbar 168 /dieresis /copyright /ordfeminine 172 /logicalnot /hyphen /registered /macron /degree /plusminus /twosuperior /threesuperior /acute /mu 183 /periodcentered /cedilla /onesuperior /ordmasculine 188 /onequarter /onehalf /threequarters 192 /Agrave /Aacute /Acircumflex /Atilde /Adieresis /Aring /AE /Ccedilla /Egrave /Eacute /Ecircumflex /Edieresis /Igrave /Iacute /Icircumflex /Idieresis /Eth /Ntilde /Ograve /Oacute /Ocircumflex /Otilde /Odieresis /multiply /Oslash /Ugrave /Uacute /Ucircumflex /Udieresis /Yacute /Thorn /germandbls /agrave /aacute /acircumflex /atilde /adieresis /aring /ae /ccedilla /egrave /eacute /ecircumflex /edieresis /igrave /iacute /icircumflex /idieresis /eth /ntilde /ograve /oacute /ocircumflex /otilde /odieresis /divide /oslash /ugrave /uacute /ucircumflex /udieresis /yacute /thorn /ydieresis ] >> endobj 90 0 obj << /Type /Catalog /Pages 56 0 R /PageLayout /SinglePage /OpenAction 76 1 R /Metadata 198 1 R >> endobj 91 0 obj << /CreationDate (D:19980701150656Z) /Producer (Acrobat Distiller 3.01 for Windows) /Author (FELLS) /Creator (PageMaker 6.5) /Title (INSTALLATION ISS 2.P65) /ModDate (D:20030513101445+01'00') >> endobj 92 0 obj << /Type /Page /Parent 9 0 R /MediaBox [ 0 0 595 841 ] /Annots 150 0 R /Resources 94 0 R /Contents 93 0 R /AA << /O 199 0 R >> >> endobj 93 0 obj << /Length 1456 /Filter [ /FlateDecode ] >> stream xYMG ^Hݹ-a7jaM28!ʅbKQKzZ2?lN=>N=M%[J>bgdL'ޖyOC2{!J2wls3g`] `ѻ GJzgCu,UC*xH6l8R영%l)X!s7 Q\q1[/ms>ђžla/T|3QL%C$A$sKhfS5XrT"Yj5zéHN2f:ӋU27WHΝ ʥ_ -Tx{K7dC*!ΑhNN'Wmf.`C*E4׀&wD[ >E&enlQ"Yr\)6)#pmZ5 缗:WB=\%yW%#;ߜ)2~ۃ-QpO*c /bXj/) w[$AERYTqDt |* LP<4x=|/AՃZtb1qt`5MMCU ] H <5RMRKiCS32vGr_ x3 n< ԠTiP|c$C]g׼x rwPD~TF0GKT)Jxw|.c }a1nA== p Ƕa/ ε좹6?<<C 'T$<VGJ(mNKnKt̂( PZ1砄WI;[NW=-d,Ioe̛{=q*Ӹ ǮH긬XV$:nrU1\f0*0q_eޝ>~[?:9qg$'ɸ`o$S7ee:mn>.?7fym.V>_/7oO'1#@}kfHQQC;>-gU,@;XjpM===|(?ʾc ψO?;~rvybnӓGG|j!Cj{R8%>>V>lMh`cWBÓT fʨA b%=FR\Wfi١o?'*D Hc8@%:Sr"4l$syuVs굹Y_|~Y|\>B5՚9ʬ;%ždVdT''o8C9黤d_Df_M۝;|Z?s9>xyYP$XuʜMqcj?z endstream endobj 94 0 obj << /ProcSet [ /PDF /Text ] /Shading 105 0 R /Font 95 0 R >> endobj 95 0 obj << /F0 102 0 R /F3 99 0 R /F4 96 0 R >> endobj 96 0 obj << /Type /Font /Subtype /Type1 /Name /F4 /BaseFont /OfficinaSerif-Book /Encoding /WinAnsiEncoding /FirstChar 32 /LastChar 255 /FontDescriptor 97 0 R /Widths [ 296 333 389 500 500 741 611 167 370 370 500 500 296 352 296 500 500 500 500 500 500 500 500 500 500 500 296 296 500 500 500 426 944 611 556 481 574 481 463 556 648 333 444 574 481 704 574 556 500 556 556 481 481 611 537 759 556 537 481 370 500 370 500 500 308 463 500 426 519 463 333 500 556 278 278 519 278 759 556 500 519 500 352 389 370 537 481 667 500 500 444 426 304 426 500 500 500 500 185 500 426 1000 500 500 308 1074 481 296 778 500 500 500 500 185 185 426 426 500 500 1000 308 704 389 296 778 500 500 537 296 333 500 500 500 537 304 500 308 556 444 481 500 352 556 308 500 500 352 352 308 556 611 500 308 352 407 481 833 833 833 426 611 611 611 611 611 611 796 481 481 481 481 481 333 333 333 333 574 574 556 556 556 556 556 500 556 611 611 611 611 537 500 574 463 463 463 463 463 463 704 426 463 463 463 463 278 278 278 278 500 556 500 500 500 500 500 500 500 537 537 537 537 500 500 500 ] >> endobj 97 0 obj << /FontFile 98 0 R /Type /FontDescriptor /Ascent 787 /CapHeight 669 /Descent 213 /Flags 34 /FontBBox [ -101 -251 1000 1000 ] /FontName /OfficinaSerif-Book /ItalicAngle 0 /StemV 0 >> endobj 98 0 obj << /Length 44960 /Filter [ /ASCII85Decode ] /Length1 903 /Length2 33653 /Length3 532 >> stream ,p?)`/OfDegIL0JP160JEq^,su]a@Z#60fBIe,p5cY6Qf0:AnbahDIFYd ATDKs+DGm>@3BZ4@:Wqd@<--+De:+`DKKH1DIIX$Df0!"+B3W*AS,@\AKX?YEc>r;@]0JP160JFpuEb/ZiDf0B: +Co%q%51IpFD55r+=KTqE-ZJ@3BZ4@:Wqd@<--+De:+`DKKH1DIIX$ Df0!"+B3W*AS,@\AKX?YEc>r;@=pKAS)B)YEboH-APd;dBln'-DBLMc0JFV[AS)B)YEboH-AQ3>W@r#snF)rH] 0Han;Adro(@:X:oCj@.6AS)B)7W30d:18!N+>6N&AnbahDIHITEbT,;6>pdX+Co%q%51.f@rGml DJ((jFCB&t@<,mIDI[TqBl7Q+A7]?^02Q(kDKJj'E+L.G+Co%q%511hDKJj'E+L.H+Co%q%511hDKJT] FE2)?+BpNP0JG4(0H`%l0J5%50d&.m0O5fAART+fDJXS@A7]?^03)n(EHPha6m+<@0K1g2A7]?^01Kkt F@&<4G^D#$3?Tn/2)$.-0JkL,3ANC=Eb/ZiDf0B:+Co%q%:aO$Eb0-1A8,Oq+D#G$%:aO$Eb0-1Anc'm +D#,/ARc2+-*HbAI[Et=I<>l)"FX;$a!QgY4]0:/Kj=,C;1A4WI"dU`&1mC`'+[@\b-5KDcID$ahJ)dP8dWfMg.a74Fa>mk<\9.M&^'Fs;:0AFh/qh,`dA_"$"+6G/T5r7T&# 7ld%'hmZBd/VS/i%g)#qfEXPG"`;P-5Pmr[9?1)T274:@!^)-i4o9i.C*p`BNT)")j$2U_WDpq_0^RK] f'68&DA%:j^mj"Js%`>Egg+h>;YM2qUH_fP%5Q* Fj7A&)D`4W4Cc,ec1:n#Du7]0aSgU=Bas*EI!TJP%At?2V./hn3Quf^:Ej0FdoLk5AP!:XlHHWC%sXbS 9Z(BNdfMVuNL(GC8YcqkXf!`epY(kcC=Bb"DB:WX%f,.;:'EWQ2,Q!e*mT-W(HR@7YR+V?`/o0Zl)L54 DOq-&MAJ/%P*3N_?GFk["Weq"B+)5Eb_s']PmDGJUG54-i:-2%CcP\Z>gWh)H0LIkL&pKCfu7l\,YINW1sK`O"F")j<'g,&)XJ&SL;D>5MOrH'g-*&/c#rg.Q3n_ g_b;8o)a_lVl,a97JRQR)joB\@Q(-UL+_;t$rH3Ikl_-#3()0JkY2.L2'L9@1."-/H#[*kJ23J4&8-eZ /R(0%8G-&q`_77kC.]e=/1qtS.7P?_a68j'B1#'%bZ$JKq(iQGpaT:#S63>,TY[d/+B(Ag3G`ht*/G)!fH6\?7=0*TM;FEsnK9:Mg_W;UMq,/4F[,^A='WS3gLN>c,A@\o lf;;aXp4_Wn`sCj(,E)P0K]^5J$/B>1Wb1RrlNVo_TAf@%m_?1X,8o%2f-_9sJar]]<@ck;-2qQ"*8S+H5;4:^%+-.:%H*P^dV9 )k^AfYdP&"&`Ki.jgOPb`\P*m]a!/h@$U-57q;Uem7F-0R+GO`g&ZDK\fR-RP"W0#N!i(&`D=5$A+e%V D5\l?It8iCkp\5WHQ0po>)s(`f!B@mn:bl4d#l;26Gh(@?O!%nMJA:"t>te!V6HOV6cQqo-bO?)Gu=oA]R.``B"EkXk@d/^9qDj@Eb._B,,e&-T`tEYnr&Br6\.Ckag:a!6^;g+6k1i"tUu"='BZ ;ATn>60qW[:$n-7,'G6'1].Ekj/\a`?>On[<6(GP;;K]/O2fh452\o;2j;H0bUmJOa&Ct`/O2-5+[iBT [X3)bV!Fuq1sf;$VQ-N:/Ns.f0G@Ulgbg-"aSo:&c.KS(,U)$[9i/@,T&g@ZS"^*KM>L99fYm0cZmKiq e5o-$9V'UP%Z@\j6e"qQ<#RY8,"BIY-OprKEdP9G"b\j"3KM"33]T-6L,l(EFJIi6NN9g386MTUWMap< F][r(4&dE%[ItiCp>Ih7assge__aQdLI8gGp2o%9E\U*B##2dra:g[")W,'e-s>U-d@<^nl$I%3fp'gptl'DFJ.#M)/g$p b;Z`F3]ahhh_TJV#``_`*THo8E,$ST[d2ZT=t#leA$kJ((O=+FD%0,XZl-$ 0,3>nZ#+_U1F'XppP8rsZnAYY+X"dDpXW1ujAuN>iro=IF:i>WrC=-TYYu@aeSd;`mY1D_%C:TOG6@Z% ?FMGdW-3s?&Nc0^BCBP6Y58EVUoAWB%1bS'4[h#m-8\,Y1:h?T-#7nq*o1roAus3:B5W4@$%uJg:/7l\ Ri=W*F^\?/1as1!R_+WOMul(ap,b=N:$\gk.s1CNr4Rs.USMD]d5d.'3iY4PoRm1Y7,qb/e&Hh@96/+l C9+>;p*i4@B&Zu3-Gs>Zf#G\+])BFm@Ntao8kW6h2o]LQB!Fr/:-+PK]i;)!&@$m/"F*gI#%snc_Q%(" XB3f@qc9!O+(EeH96Ep@Ba,0jl?Fsf;^8/rnKOeOF?^a0>/Std@/-l><*gp]sg?M=mYA2iQ`]9%3AD7/[(XHlMb>H[NqmtCNq6'OmQ^QF#b[*R@h2HmtV6H13&6b 0Ut+OF.VqeY:!r13BJ%4qgq6*APeF;hMS"4V%<:lT>jM\K':M^NLBXHbET'l]I*1H3W3k,W]0F`Jm;'o"Ue1.F;&r=`a!WcC@>[2fqO-*nURRnSl-N4G#m45< M6KK_>l1cY#]ZE6]>hkl6.UcgfC!Ll.qWKq9b7C7Zg5=rr)h7$J`bDGcYfE.$Z.;2(<>33g\13QUhbNYr5k5<&Qr9&Y).c[HuT1VbOVRU%-3aSP&i/cN.'l(t!f-q9FaQ;_Pg*8)4s5OAVgIkFjKl<:_uSd`nS&,L=3Y 1>s,EPaeOp/:c4*MCSd>MTO#C6hI#?kGVoo;^)"j7sX]l9d\*S#/^q*@,[F`:=4oK?O$bMC8b]>2CfD1 Q+LO:b/9)c)'e48_!eo'2[DV!VW>N*e!dB&c\7T[5r6fjXlq-YBTA(3m&DPLYTYAt!cgh8?JgD'oKT_b1!oTiG(gR9`L\JYK%]sLB>l$m<*-!eB9/TbSAiMT7Gbf_=,ri8)`^>;bm6\(mhP6 q/=alN:3K$Q"]!#*U%2e;D:\;9pEof:+'`:25-b\j24!23KFZpO>#i`,);Z3S7BUb\Jc#fUtc%+GAqis !V?O_em*.@OAOY5s5/nU+sTNT?)rs3,eqa/!XGD_jFHP_?&DW;7qBdS2/nYhZ4:uaM.#kTf'B;JB[dhr Gp3j##>%3CS-Ue8rGdR*rocU)-m8)*aTXT\crZ#=gL^%J)mrih^goQAT6<[7L5ab`0b$$>0:Q12@1jKV Ne]cP*=9OUBTef&WFHCu/jMGk2_'o]C-pW)U6J$6B3H``3$92n!Qq.i\[F.'4fcFm=V1.A^0Y4bB!+S' q<4Ho%Cr^o?&KT5.S6s7p5]"rqu!FQN:.]ooB;B0F^BIaIUkWZY@OijT,=iirp]dm%qUuF.C6%9MD@-s 7\&Mlm9"m,5!rd(Yn8M/R]3*G3C-kTTZZejB;A5e8Vi1UHO.Q@93+oC03@7Kb-"b&hllc+UOqu^rD/9U iE_B,Q-4 fNlCc>%=C.>kTgaB+/o#.sXZGTFI/eim6U1[-]tR=]%?RmH.ne9.gV"aK"OIiSj:3%!S+p'6^\KJKlW"S ko@")pYL>DKQ&2DoLsX"\-@G=$hi>IHMtBco(h7Qg-:<4RD_2NV.'9G79*Z"^TKt&e`I<)^AEQnDuZ&+ >0L20YN<]W&CM+]IV=mfbq7bZ,Mnhi(+'Z823IX"I%I;>]L!Vtn(i$5IX8i$hq%B-#oLXk^r.5mZ?K;O YqOAUD9Uo5*ni;tCJM\E,0&ir$C$?,$G,DfhTWOGu0W+;'ZJ-:c(GO$kajes]\4aMu',4%irIme;+XJum C!4019F5jH?qC?Nr;,aeF_L^-c`p=!5ZD=m#uRF#(%F.?P(L[OQ1Vm*b;?`lW$qT%)PDEFI(%[rq*\;cO]6lKJI\lg=fKpFNq)[*6F*3F A_LNMP1a*#2j.q]-un-Q%N0C8mdrmDg98A%BR@VhSHPI*.FRNkC2?-bS\2'm9\ik\.dLQYnli][OrD1[5J`ifn'/YV=A!`E)RdcbF:t4,< 7c==RMOf-f:t@8f@(_f`E[&r(S\,lJdse-OB'XfAD8"0dO0E`@T-!@;1FEPLRkMWmIOZH,A_/H3HOHm_&Wi$ZRJ9s _m%R:qKrqV3YWH2On[+-#g7\e>=dYuL\Nr]GXpW*96Xm':6>+;1uNm9^:17;49(52BVLMN14J,oFZp]) ?%DS'GflukY4iaDcA`oio:_+2e;61ECZ)761G^mcdX&=ON)LZ-Y10%#Qt9^TReO!Iic$WJ(h76i!d&;E K8jMm#Aia)b^K(^0N0gEk$eV9K09K!;0NZ0J\/'*Oj!=:`o,Og%14OG#TWS/6Kc&h+0u^50K3lsYn-oX (c2r(G)n-iHM;'^59ljbZL'(>VhlK2<1,[,'r-cRGN2gPc/-G_4IP:u]2;!k;'HfI%+a-.D4Xlnt)Tu9Sq2-G2gA57nFbUUPC?_iG>B_8'D!uG(Bj@Td6%X:X8!uDh \K8:A?\H$[gj9d7N9;t$:rFZp=$uC>3Gdc%mYZXZnp8XCKM93eqVD".p\_%o*%=("#B?j`>@RNL?p82]%TH_?Nu`?G )CRrm"50h*fdIBmBahmF!;]p].2,eRQG9KJ%Sau"AKP!>E&f`Fh>FHS([99hZ5io7+B)",`B@YSTd#MY #IfuZ.&>aQ^%a_\?gfc!de3N&F.#f[8Z;RGZ)u19NF'KkeC6)5'*t>U?XE-N2DVC0#uQnk9k^Lnkd)n+@=p%E40G7YWK/^`jQe)5\8rLutEiO-1dQ/&)O,):cNpK;CEYH`%FB+!0 et>F,%;D50.d=KEP]m7Hm\B=2>,,HdO,sS#g1@5S:$@B"]3\jcfJ4(0&1JU8GpebkDnSN;D!VtCh(-&3 _Kl@KQJ5ssS/7(`k:[!$G(\SW3'W-aQL=J/6Ob:G`mCWA3Vig$cKro%GGS.H5`&5ddC[1hKA&]-n.e3@ l/8h,PIq^L.CP6P*N0/-c9jHuCS_.-91k97-uiod;Y6tk+2.L3QXhG@@@hHSGdTGBV)Y`G_+q?eu&I8E^r$&+TCY qEk)3OfjNo*[SJ^;ngb5!4VV5Q((UbnC44[fm`fmLo<2!Q",'*g$j=,N^[h2"WLA`7L>`U8lqXmFe;?8 #j%4^mr`qK$3WTa&7RYX[`jcY=qW0?*-#Kg(C'Bt5AFsq%fEF%f_91s";JCsOIK\X9:kSulImW]7.iX; 5^6%"=4072]p5-4dTg*s5nm8hk-luA-Q]:@mLMMDB8?:9,jGFMdj[j2\F`u?WENnDMZ 2jdtGD#WO8ATJEk*u39#/>@ifZIgPm7R0+>KVr`j\H%CG>UYad/ULQL[8+7.;? 7\'`7DFh:?K\2dR%60G.B/UA*':,SWjU%e@i5CSgqA(h<'oP2CMikORH?abQLh_nI^\8=7;P6Ml5aC6- J_Jafe@/kb;Khe1ka6X7352b(ZTSRsZ6.C^iJHdqMVRieA[%E,cI63uI:&P@Jnbg6H.LEW9iqWJ+7Pb[ nFW[E4&`u2QOMZk['3nJ>pu2M+R`^j3Mu(E*7\Yiqb0+L3`Ue:YY1hS0k)=u]Pbmg%?D/t&5muhXQ[tbc!JWA:-3DIY KGWB5gl3KoWd1)niJiDg)/n_Rfj*_6b1^TGIaBNQ4P_FVH_c/\=fY-(ElLU;J*+W&q@-0:tF8HX8WS#l6AjQV8A3F<:>Jtf?KSE#&/m#P\b?9fhkrq]P q6P*pd[l(TJP#"46*pV0S[j4f#:()[K$Mo":t!$^gn3a`EJ3[Xj@6"$o@=L#EOb>(n_?-IC5;,k)o2C5 @6t)E11Y/8'9G'IU$@BIl&j#<11.sS7Z!NcqJJqCMG&fp<6hl#epn&3!bk]j*0N2bS%%N;dKJU?A(m3: gr]a,Pbfu:Gfh04]9eF5G0^?!9=$R3SGA]VpKRk\.PCf1ac:+pZrfRrmIJhU[nb*nI-*slp?p4[%KFJ6 NYE8WFHDc`WfNTeCCpk3DW>g; '#:#ON@eYY?ZOj2e/d@o''$bPj[R2]F^Q5-e8Lj"AF(VZJg&`)QJ"=re+'I\A3CpjFr88M`05i`\hA'< @q:QBfd@,lC#&OU=PIVI=M&R>&(m#3a,_\9WFe3r/`[N1I(9D?)M;+&^]GGf7B0@T?a7XDQuqW#=m"/O2,tGK25??W-p?"C@b0%HRJ].u-_dZ<`(im/rosT-WL/SJu9cnRb>cT8WcmkT:3? (f)a0F6>?LE)+",iZ)eRj2A]2MT+#_6ZYC#qUmqqH\@1Wg2K:$0ZqUFF<]R$Y]6*Sg7ciM%>F)9)84Ag .DV)H)S/Lic\;>#T$",LeFhhC(M,gRT9mFWl(OAq//CS`r[7#8JGeS.TM!Tt_S!ggV(9j6r[g#_r Z!MoLVgc@(,3IYZ+VUM#20IUThV5t$j7g[!?WDi/1<&9:orn_n[utnAM%Q5eL/D:.k&c*b >X3_7A$J?mH8?H6HEY_-o1KT;g_SWW`.efW.G!]c@PrTW7Eq;MI,VE1@$'gX+#ATU'ORjBc'm2>HhY": ;FP>Z;-Kc>)g46K+_nlUj'_i-ibQB[cBC7WDr.^3#anc?n"A:Nq-$6oT]LH1f6f/jH[&u&8ZCZtY_lW< "Nl<eBbH'kk5;2apMpi@\/8NNI;"1/n8PVJft cXV9P;*[<92O09`82+s;BE83`P?b.=ZI5kBkfnJBq2qCYTsXdtIQC\.R145aF#2rH"FZ.IVj0!CpFiqtlV@sA$rptoZIH3Of+"9aadO(i>)0FA@PRPfY!76Up1I)XL0d"t2Y+peWb`3:R$B_`Co3 B,(-*2To25rMni\XHTE;-a(ME0b?nlnW#dQEpd%U3:B=aLC4Zg<3U3#j3t[C60t@o-..+oJ^Y;[Si%KT ha)Cq4G(-6OQJki"?TH_KD'OFplh(=!)D>+$g8GYM#oB%VS-?;D0p_qI2U+[MSMk@=^_=X:>"Yt2nA+g 1B+p<2T,Zl-tST3n)%6';Xo9n"GK*Wi\8d9%WScRNil^(@sN.-49n\MEDjV*&@b0 lf+mpU@_Ti=T^#2E)Og(C1qgF-mEMR'sLDE]^aC=\)Rr]a]cpG4S&ed`2]7(D?&'"Y[i^Md,9/4+HR(X @GsXf3J>rh*M8ETmKq)W7jt]('>.l<#?s,(Q$XE'q#j1llu>i=6ci_37:fC%^3M^h_t"He01p3AHcpk7 a;)"0B7mc!@]O>p*t\U2J.bXLqWBKA&[CWMC]!p2^1L`;Ss%qHhj36>"@rTb$4gtu%Y#^b83#+q7WF4F :/hc+L=f3G1oB*%pdNgEcfueHX4nsT`'_EYS31XsH73%f/D)*c*8 YL=jR`1n*3]CL%2b0*K/U&8nPJj"_n3\PkM9Iq43a_II>0!Xd>/U@5s1Qu=VpOQ#W=7JVWC`!",l7i2m jSa\5LYtV%T/3,AoD??*ZJJrhJ+020>Y5#9>^7:9_@1'DK>W'a/KPQ(U$^/&pj'gad`Gn88:(MTO_^^? D^Z6*K.iq:(&ScK*%N+>`!tsVSmSa:)tt(1Gu.i3?*i@(4\sAfYHP,I@m4/-++6j3lrJAIEc$9M>A*if L#6J'h'>OQSmQ3H-=u[*YW5__c'YYjR#!9`OYaDPO,B+lHNKZb5tWWGa.?Rpar;qD2=UL,a4NB/SOA&@jk!j\FRZm&B2uP _sK//Y:t9&A;OCFe$>X0GDrf.[f,6&rg$/qmn3;VXs9"o4ADOlp`4aV=/&Rk>;bJX*gD\9=V;Y*jf+(, +]p$m6&^#7$A^lu6hehPoVfoi?4e1!`$<^;-!E3mlKHXsN&+=j']n%SNo`c41M!MYDqS?L8e]2,R7.^M 8O$'*"&?l<71k.dJ0Z9f0lfL\8i8,2#L$iW+X4]1!58IT%0%2l3;M6]PQ55oQfmt?NDY`]dtLXS)s_J2 dqJ-tkUGSN/28\S5q1DE>BTE0H70VDS]3Lf5\GWMM.+:oZ\0iE\FpD[Hk#@sCV.LI2KL'=0AcntM+0?D 2IO^3TN37+,CXXB:DePd0^VQXq@s\KCQdt]l>_WT)lXS!f$2\.q='(-+?8E PA`ujs!C3UCj+P/O*#@>QgUJW0s.o5;US<_-LM*r4h1>A6&D8ppus1u;lMa=+ia(a'ke.@tTo&/p^k,.?hhMEF /8udc^L`4F<&;;^(ZfcNoa"](U0XO=fni[!K@ug-OHXaqOSpW<%TW__V&Ze7^"D3nI2:8HSe%UPk_P:? $dS%<][HXr5J@M8W_J=53^gLsF5tkV$Al`r1/m2_rh,P`R]=qnNDR[!VoZS[@24@lMh7IH)RqYk'\Z?] \hsWR4]WZ?WeK.Yj>fS9/_CB%CTX%*"MSH_<0d$OOClKn@Q_a58Km@[-jmSAQ/U&+9U4jA,OYDV6QnhQWB!0A!0$bI=>G7S7_&:`1's,598:Ol@F#0R-iQ1%sN5N"dGu?)o^l'i2SgI %KFktLiC^9ELT6,-%>ehJ)PdgC#=>V=!["t#GA*LBe.%[c?g\mh`HC(Z&iY)&E]N3%\Nma:FPr52CZ9` bB$iV\#Yk]k`'ULU_[r`+rlI*#*[,+*47Sk%l<0j#.q=P+34@L'DHUQHi&XlWKSpH7?qO)@Gj?Q@`lO, *e;Ug`K(9fm+qK8GEPDH@+===_u,QPdWsp41^&EmV`VNl.$LH,`M:8\O^9U^"sj4=6$L`jW;U;53]C.0 '9g7/F&r`,OoDaU1)*Qc)%Lh&7l8-f31WOZFma/_+@WJhXX',jHX`bAo6_0Sfro(SHN,'bHU$7;Mf/CLO$Ib`+14[):c3#aa-&@.j5\Sl8ZOY6E)@ps_.em1U%)Np=P 5D*'.\Q*fI`q9W+*67c.W`+lZPd-kS)L&@aQk3Z="/obr-.I#L2mNa%NUoC]fVY>F:?N%b2nrd5ah%fG kd`B9ZRBXI-/uP@%;FuB#:I$ul1Chn#2-piUn;P,nC>a%=?q@WMd6hTc%X&?!jMtZ;SN'$7$\>I"SV\B nAbtg=aD^ '=a\'1KX!FKDM7$gEoG::l'1!/KtJX@t%.7=7D=23^$ji\Lf3bnMju3Y7[WoDTP[.9k\so3'`;os*gO<>@a&2+O_Jpd2VO0Z`4!"5j]@p( Yhi>&R:],P1qle)`\WQYBF<4JBOp5h77F'.]S0e^UDl+"3j 1B*]8p/Y$pPD/ce:5?I$]CRjTlkOM-miJKP&m8.(,+)i:tq]h1AUGY'!A=ihMAljefU&2 &%@c2O&^](ZpfOq]LK3rrD)]`06Oa[k1ho9$bTB)OWals("JAM0le+i_8Ge0 ;.4@0'r&'s0LLX&n\E2I.4mO#dJ\N0HJk+YNeVE)bcNZ-VjZ44gVPpbh1TIucN_/<""2I;([oE)7Ta!d?>rAGDOrt(QYgB,>X I`\,";m(4`SV*I?Y=0s@O)fN"S>'Dck/J;-r3c[Ak:KO;3ZATnQ])l&5)VdYBtH.4#? 30cu5.J^]/YW&m5fJh(%.6uXEU4VRq3q+YC'g24aekabfQHJlF.Wd8FQe>@Z-cE$[&Ap;I*Q,V%_(D.:(Sfi`b:W<:fEEZ\a"4OcY*%*fS9#k'C7_-(;U[3"0`T!C!^-^mmLRRke4)`)[W5#?( %i!e>Z]^qp"DE'2D@9EtDX)&HJ[TXRUi$W2&cGl*Sr;mJ?5`Q?Km$Ar5bj\/LFUCLou]pUMXZB(^WI%ToCeHP]PZacLQX,[?nA?SU.gQ1T4mW9mQLL$JFMgXd;7o@n7AaGOJp5$U]+VIjH"-HJC]IIIlZfUSZmQkl-Vs6Y530Wf5r].@\-l1O$$Tg1`V*)qRs/5dg"cm<[.=Lf6HFi$8"VN*k.U%T<5)9[^9^:kJ);X21fgNYfC[$_@40[de -`#@gBX&*4C<9NnM$=8WYiC2AV1D*FJ"c-+#,ZFa[V?@kKJ+V<52;7"_9LASU\@F'fH/He@Iq,6#X%>kJPQfD=^KoVpKYY^SN4eb(Ta:n(HO`7 Djl?LNi53;CI.CT<&6f_]VtoAN80g0\3(r]5]oej_aDcLiE#HZ%3RfD`!929!"UD!CYBLE7/Y_rh)/Q> ?>;$^Rbt4@l;Z_bUhKjQ"M4Q8i..?Sf.7pjHCUrE659cAc&J4/65Yo`LK#d>H5`/G9N"@29i*HL7=*1Pi4O)[mORa,Q=Wh_]!`.fsQ"D9CoB%`mjT#8*nD-c+'N)c8R?UZgZci.mjJ*4^e& ]W:0Ip\FaX7:1[_;0bPM:\7:NhCX'!r+La^?m']rh]]nE]aM*9X@?rtth+ =c4-^@%#/0qS%kZeLmt7/M^pRgL/M$6if*f3mWnn_p]!i>^5CDTQ+k@!+09E<:.mKGcEaF/C(hJD!8;e mWA8QLRo`-@n0[*qD&G#CtL0&^t(fUQjk>fC?0d#>HN`qt,j$,G] 3U:o2Erd)ih>!UerK-"A(N,?MXckXKT`1Cn5VH?fTJ)m;ej*u&-2(J.'N(?sB+;XhaAJbLZfhJG>-nJ\ _OrHF?"?B$RZp[F^a.JR+GEbl4F`(BnmC'9Z:Lt=(@q$#KW,qo,F(o+rS/k(CN"=PEoD1qTImXRnRfZN *EDbC9FKT-&[a#7p,FmlB'ZKVP5c^qekE^^0$23/6D5(hOB%2-T3Y&IGb$OBCPk9;ZY+Zf$Iduc-%IJr =OFC:L+UsW4-$AeC%ZQHL0V+:l<]Pjhm@p)>J:e.EaM`&MD&H=\7pg^P:4/1+B]3K!7pI6J%aZ8=a6N3 ]>>%\38`J'Nejg,OKC!b(@"Q;gh-!$W;s'.u%SF2TH.u`\>,NJ9p5P$*#370!("]X`P_8#OkY[UT:/mN!&0E6PQp)t,\B)cB]]VY^G=e6b@X:fpj<"] fupA)Pfol'7r`jfJ3c\q5A2;rIcd*EI.Jb0egNm@5M-)AP,NtRa:V?],We]P#_^?r0GDB!`h^eZGF2XB L5:O6"D.2@d+UtI8U06=g*Gk#j(tLSQ,/OT9QjL!$rs;Mqag!+-\U*cN63G[NAk`3g/?jRbb<*k5%teX 5Z+/\bf%G2?Tqe8G"n<_l*Nes*W`(*6d2Z?`9#Cpl51e_q6AUCIF)uEN=8EA(=8t; G/>:,:n#q,?&.6tB:2`@HAI*]EfTWO:q>b#n"=WB=Ab@26s9hcIF9Ja5;2YS`=isLoM/4,n0:2t./C`h Jjd"2bhc!.*:kWc,8P]t%Zg2p1*FJk"aPalc]F\M:+?$=iI1"HdpoG*J.hL<&'FMl/u]@Mp_B$ #ID)h0)_Xk/lZ>tMN![pG#-$HPp cQ)kn'I$::In@PX9riuMgTKF#7s#+n 1bUadK%0\IN2>cNY#pD-?Wb6h;?T,te)kH!I@Wr2Sa8N9!B'^+"e(K`&U\%A#CG=*PF&;PI+*h'aq\maLV'8W1YT)`mQElHI\t.7Lh%Z?#ljCG?*f<[V`MYpU9.M%X9r^2_m*WF\ M,Pa:B;ci^rnZPF33XTHU6*QVG*[B+-^ #g1XSbjdC1@n:0n)8Mq5#AM2%T8Y9c0S;3&Wo3gA@E-CJ-L#%]/]$HbC3VNYh:\&PW-M"g.t7IEip[S= :Q[dWjeReLrT<4Rf9uOaZct/l(/@g+&8T<@`63d@li]`t2G\DUiFP#*pQ@\/V#BS0$*uJoobp"&a`#kg Le%4-k?Fb>D!Ppeo[kEI)7+f87Hk95WK-_0\sS=$j[_$R\@0$?)_!@RraPFS<&VechN[3EGkaLd$AaXS *LF?XT5%N/.5_MQ`>844kL&\.FF)kQ1S-?'7]`e?Z?ko*0PB(ZF*>;#LbaXAS'2DhR43mX/Ku+IA?\fA F73e#.Nc`9!VpUQ:^3lkD<_T:To^u!?IK1:3T1`fl,a'`-8)u1>I(]#!tdd*!eZPT*aEiVq@t^C*4Rk? 6.UB>EdYT)JSHd!l!=[B^]NB?Xn1i[[=eNRA>[?a0=9:c2]o%a[?"GYEKb;U,kTeqYFF=!mY:AJoekDl a`=h:Musf?7$Sl14l6\U$Z8!+=5I&;=Ib!`^f]gPKO5VJhg+r#O*4#'q!a9_;q,B]?NK8M4NF7m;4?&Q12HoQigaRDT_X^3_8:""Vt?%Bg#bLR[f- N[!s?Y?NadnYhc.qYfK8ZK&-t-JsEkp&/A^ 3OEkaT@E_Skc?c/d)N<7c:-NCp^[req,97@!8^9!lLk.5)c%JMVERNY#^q[g1:dM\%JI"/M=m.%+hcWW Vf2uc[qd*%,0c.GfT'I2PYto-5?d^,QmU'ginsr]Hc)`[B[!GKC\.1^BmT%=2m0 oe,]r>.*b?.>N9XfjLj[geO-Z_<+g?9\V\:tOE/3BtsnoQ8rTCN$nel[1mMn$bUr>:[2)*7igMHIHX?.61q e90-fWE]=)P)Pt5WU8D6$[><*04)@mO,Z(5+"LXP"Q%lc(VO=RG!j.FDEK\uLV]=iX),LmSS3LC1-:RJ b3kjdXU_;`?Y_3P9Gc!4ICP(tkW.gDe\ds^bi6,U9P5pjL95UWo+M/,eZnB)s,YN1Sl7V>ESoAHS'V#- 6s',Dr,XZ>J+%`3<.tiWh?0PERg:`9N/B-9i5!0GX?lil+c,ktT4Op`nj$](p4p)_Q8&KAO mY[])^IVp''SC[3[$g0Ei[LOo($T'6o8tq>Ep4%L$Kts:JAn2ch+.h`M]1%-1BE;;ja[9ENa17sYe.F7 pnQ3cEK[hlD`%Tbo8`8$%FS'di!!NR$ ,YRdJGJn=1_iO/QA(LJ,E!]eUKjj4(Hk`5'r4V:;=o>#cCgp-4`@fh-H)8EWdn^u.->HfOeq4OZjJ\;5!nF`Jb#42%:il:n'jLHGL'4b9l9 cimWaoZ?TL71k!4gJhZ(W.TaO>FVm?)S$77N6Q[4I)F^Qgn_`\]EdVDF$^tZAF!s3&bR/l&jr3JX\mC! Bt'8conQ_BA;T?)g14Rn264D:p0]ee$6aB4^!th_nt=pS(1+m^M-'B'E0h[]LWUm80];X(8e:o?i4Y8( r_LrKf#N,Sd>2f3]W["$YjKsZ2/1Q_&@tt)f^QEpq.q0t0fR\JWDaLmo[8gBB!qn'`gA10k*rqcta&bgkrFNAnjg+WA6K>!T2Ap&Ck!@mt,!s2S9Q@@k!j[+8ODDt\o0J[\&* $hr_Op'=[BFub[qFolJiN7O5_"?^7(aqfj]L)o_<50oLlRZX&KYhhWc&6[etc_qdGG)30`RFr_&PW"K5 X(gI)ZeZ0FG,C;$KPhg-?<`KuE^:GBfk]\b-P^jJMgIH4(KI(dH,l$>O"8&-8&\it`4fc+28p.d,8.(6 bE!hEg\3ie/el;l811n[l=(a!2%U:X74Ip"GQPpYe]js5U0ck,P81cIdV[ok@576#7deof\C,mE_'eO0 CO&7I`XMtt&+aC9?q9[Gpr4jCq@\'.6tGaK*]Pq^dk/5FBTTp<\6f:5,8b(gj:k:gOZLaNkoSdFg&;!( Q:*`6UWt5pB')@&Cna`J1$f87Dti"65iCr1gXi,!,-PXC-[%W5HoUAteVlNEE9K3FB#])YqtdQu,qXma J,bg%rM;5[Jgi.dCRTQi5<6aH2"0(=:X``-VA"[A)d"[Eo25!V":aT;jg9]?V`"2 \nS7h"nR@pWkEIX!9ug8r=TI1qFZhQ!aeYK`Z$`4ho['\4a0Tn\@W'mnS.t[c+26>2"T4rWc%I!OjK?Q Bsg9l!FsHu2m?7aKS#Z;@^]pVl>j/FFn[4qkdG@)?Ek&uni)!U+t/$nqKuuqFXNs!pZ-X&+5AI`+>62U ('h;iRU+h59fECLW-X3b#1Wk)r7o9O]f4h]h,@EcmcZ_6`u]s5TcC<&pO,2p#Dlrg2RMJu#Z!["BLcji M@$$&[gL>d=Rpnl\FAB;9E^5L^^HV=>qdNbqs(^!okYPt83o(L3SQ.LnR_.#fS:;:RtgHr3TkJ^8"4mi f-^g5!;=5[#r[b,eKf<)fcA/*PP7K!/n`3UD[C[[2=nq3!<5uZV#)tCShiES'%e`9MO+g]-_P"!]-2t# 6ogNMLRdCfETA@0,e$Bi\q7iZLP8FD?0C^&_9c/U`I"E$m6f:&CbIXOTC*mmWjH/A>N"C_D/"Mplae"k I&Mb"H;p(^K8n6jKh5$o,&:3Z&k8;&>/70cq*Bd0Z&qp``3ZJR%8Krt"FoB?C\'Vd>)#hpKhP+MUa+"o iZ9;gBdCJ'+rkV\mjJLabn'fKq/Q=4*5B8EG2iO5MQ',u85mb&JdGd@@PZncUi/E4\02!RLAIYc=noBa P+!c,H1:'VRem>HoRmu].T5LgjAgN(B6cc>$b& H#&#^WlaE&UZjP*?@DpKNKa10Gp'mr-KuntZk&`m2T@;"59CT7P"<@4>\4+6S2K.c!nB(*"$Dg6arkbH X1/oJ94F&=A9)gKdY\*rXPbh3cPEK(_S+IK"$)ZR\n'kWfNU4P-4^hZ.kLA"l(,-Pqg?]7$1b"5crQ;u Y"8X%]ljagVo's_a#go1Ou_^b]4`h?I"U`V1os0\:)KrY5:+g.<)l@/)=)i%?MKBh*tojgb#Yg$c-'?g["Jadk4ZhDLYnY5m& _diKs+BG*;?cf.2DS(?t&TA*?2pTh2*i)FQT`"?U="#&#BqND5<$godJ;:,`4$HM$/HMm37Le/$2Xc)0 JD.ZN(d8`pm$"pEqK3%'mL-c5&S]m>f:XiWILP0<_Qgt[`qt$o$2G*"0dCZ,e.QnTQFK8Rn`:#ueI)Bu F2L2hV`@G'T0qTb21(7h389.Z]$f=he>eDCIc_-3c5"D)WhX3FHBY%pSg52]Z3H+A@5M#=-7c!gs.Y3I r(7":XY1Er>IV,HFa^sZ!ZYna7&=0Dbkc2VX;P5+,$50H%WCD4-gTSC7P>]YIK;9R[#O o%Z0l8/ua9h&fCu\^<26glML)#Qb]7D3/q]#KO1X@t"f52=%;c8)M5g)Q!Z#>+:PdQAgh+*Ob70E#]3V PdKe)l`bhZpNb&=,X4HR\#tie;I)1TLTWY:s.;n(U8]V)2)(?!aSuV7PtNp.Mj2@sOR0'-]$Z`CT0a7q Jd]I=JR@%O3:WI+J.`uG\6V;<"^d&mQ7iPH_?(M3V0f]M8!?&k>3DLSAT3\_4'*LL!M@dXK=+JM[A=,D 3h=>5oMN=FoUM/&=.e.0:ASkm?"Dk*[)is/H!3"X1srV2>ZnFD>H;u!gG3R'&S4>DLR0FQ`oNm$!lRT=8oq+V3&4i5r`,h1BJa01 [K^I1MinX'2leC80eA#ZIdD7B&WF18*,No7nYD_D&5lZT,[P?j8D!SBSn91Ab /'%>GJ?I[p_sua$W'i,VOJh`SK3r_l+2+o6BW1&i99b#a->U#ATADe#n,lFuqf5@XDOGZ%4Td('C'%8qOE^A_e)b^59fe*;[M ;ilM"Is?Z^)Mi>Hn]$K;n(0PY+(r$Gqq_dn8SNHTQ9Q"O[YMUo>d[RFm"*?"mahsQ#:.mMH^J!MNUCIW P+;$6-j9S]8U4PA/SH]^P0@Mg`rd^P=/:mmY^o"@\?JlU:%t=9d!W81l93>f0Q .qPJ]-e^LT&@nnb'FNt;\d8-5LMk+tm$GJ$U/FI$R7@+[M [f7E>g$@YET,TsJj^]K$*4sEJ]9lPE+JXr'f$'C\CkbLU-"eI:"2T^mkesY"r5m;TS&3G*Ia@U6[U"hb%B#duYt_LRNW <9\:h]S\dX8HZ(i'8B"440H#h3GA#8fE<)If6VsH&schfNH*i0aWUZBoOgFN626jdenSsU%1G'WILChX9FC(P,)EtkfRJiH]&;o3O" &C?aHZ'M$a'r$V,2TDs6]k]Cs_EU!cW^B/iZG$GT9aT<3eh+kSA(-J0JU'$Xn"XgR4^o))Se0a"3sBKF]O8(HZ[3KL9A-@tV/B2l!q]/?g"AfJ&?<*4]XSsDRu@;MDn5dh .1BT,5lu2lNr%lU4QP]"h]p=E`@>r7n#O:>Bn+o%O 4,_(<>62k(akn\pTMe:sTA["pp2`sLDZl:1kJ=q:Pp"$aMmDOeBo^^,##Bhgj)APD=-'cNQXS8T3[)u4 L-'kN/E&"WM(S IbVA:,Ck^)f8#?F12@PjDmG2ZO.G6-E,Yi!%69D)9K@""g,^,]^= `:3:^f,_:M;EZ6-^$gCsr59.ba8@K\TY<'<@[8a2"`eE_RA-"Bf6L$[*",=q2#'B;,Vgt0UZWa;oi4-6)l0%)m!U^uY6s1+mE+UIrJBZ_+8\A*T2n%n\,Nk/L%OQ".KQ%eiij(&melp^ ro+NjY`%[(JfO&sj]sF._b%RA8/QU;D;oDVZ<*b\a/gddE^U.YM1E8=e$\^mB2[4NkmT@?&i.^h>BI+1 qGUk4&%g5Ls+C*GJu=_FU"gUg>a,mBH9+G-5ai0^8+s67[uEJ)(D^31Rid)T-=8:,nfECrgh81qfeIo^ -WUfcdeauBJ#sNa:?'W?3*q\[3b.H^UKT@&RoJIODda:s*^M:/l(m:@*Ch?#"0+/c"O.)<2+5[(-iS!& q@O=*AgZSe9O"Xs";pT._iJ3[WATe'&4.Ne!O *SP;7"[Q9^ait.PRd*:Yd38n5M2=/(QtZKC!`DH4%s_]KAH]do\R?4[bEU1gF$61]H0GP[BG"u6/Nph* qPI?0pWh+BB/!rN;WKmR;g#.@^(d^@PL#F9&_&qEB8/7TL;JUF/koq^+ThK7RSoSgE:9g:B=!K^E+Dle A.)fqGRa;2hGqj*rMK>p)"jFP/b^V&e.k^79-_JpR6m^c>E6IMJdbMK&o7<.&Ue'ZgkJ/"WR+eJ.YO#O \2/4QU.ltH0uA3?2*TR6!/Bb!TsS@oJcAgnnrC.JeF#3.=0O892E^q3N@Ua0l-c0cZNg\,UNEkjA@uP`i">EYX)792H,pe@=!I()DbEIq.f3Cd,fB*HM6J\T98Q&V\DF9Rd9/\5/: !n`Z7;1=:D1Ugs@i&B!^P:''qH^eBIBoj<[5;oo6O($0:M\%U4@qdXP(Ngs0ip`CV=5l3W_/gfF 1m$*4+DZ=Gn.J7d*d`92!Crr^o2/VO2J"#j9WE7,sJjjTl&'=o4.lkM*NN-Bja"n:RZ4WkRJm4q][ 22A0#=,qi,#U0J8+KHjbY7j:0422j$>-6/c$iG/'GL]p6[G74ACHF[&Z;2 `aKCJ(j`Xp2W;BX3iq"F"jrr^)0_tqj'jX\4lUCj=Y_e8Bk;ZD`H!qGV'7!q=cBY#IZ`WCd9n^kV&SPQR"JL HmFL/)q!rdVclYECOd-^%Hf.?8pO8'/=2iI,9O[!le_lGqOH&hK;HjGMRL4t#LGc%ZWTaBY(5Id+hRDQ hPM[pdDn!\PZuW&3g0(uSN#BDPj=n0BUaW+1EK.6#r*h]?mDfQ@ZT7\FQf-$P1p(8d&9Ph)%?0:P_MIN TRd&*>fB.tihNoA=SQpKcY>h90aW0_>bs_oH`,eTB]Ra$8.\sbc0#^sqjiDk_aD@TE%?q._)L:lDog$* JF*7H7[Hk[,5GI7>_T`s[>\t"WmMl>DC9N,](HEWKd_C[M7?^:4m([4fN:Hk5tDS@>19Nl$(H$!]r!FR >/3jB V>(l;8dP5spWP6r[i3hd'G,^YQWg#64ll/,9ueJ+m:#ZrH9,*,ojX2eNURpp0BImlm'bm8Z..?D296Y_ L<#!IV%MO@p@5f*pd&Lt_Z)ZR9#.(bL2j0uQR\qea^F7er)":#WP$m#Y1Ud(kUT=.)!6kMYW%+6`4hA@ G4C"/@4=.@f$M]Jeo[:Fj**_p8W^9@F^KLEkFX7)gNrF*B=Qph*fZ"F9:]@W4qC[s]!ag=J&n9(Q4kc@ ]N'-ZakI/M6Rphq1;jW??Di)2o*5\_BXobWlkH@E#j"P#hdaWG,QBN2g"PeA-6_@]$d8W[>)L=b(/];g[+)p"7jA&'3SpUYf&5)WkGI*@fcP;OP-B\3Yj&2p8W<[A -;9GE[+I%$28eok6?&BdJjl7R\C%H+.D'?8U*o&OWnSaQpE)DMhHO+pCA_hUoJDI?[7,W4$<*+`s&8o\ WfreAdUg;gIEDH>V39pN?EaV]^/esdoESRM>T:K8J6[C!F+GW'71dJrr2>Kpb?HtuZ3p*drE$ma ."BS]5ao/#%Q'Te*h\*!Ar"?sHMD)Yu(Rb.gH=_N[-X?'BU4dG2>Fb\TX_j:G-LA.Wk\3?9]-_m% Mep47K5LkoBsm@[6oa**7nAoYIGKRMZ;5mka+;OiWrcki@0T-U6CC0c`9_DI^-OeBMf7]/<^^ZOMQ>'0 Nj0^F1^E$Tn"3f\OWi&M6/:V:)L'63O/RS!;Wml+B]/d@iF_>"\fpMSP%-oSQD@^>4aCoZA]Jqk^F2:, [=EN\Bh.Glf\th8Pq4-G2_c8j2E;F?Re3J'5i:HH23qpPs7/&c:7Y(MR=)?j!bdMI4]jL36t5E4^iVWP g3F`NZF^&rN74C*6kM@FN)&045,C60cDFGbP!"#I^o5`c?NPd-+e0W6Y%+;gHB=U'arOhRa@QmggOAI7 4T>F@3jRU[DhDaAI1gJ\f`cIC*Da"ELnon"LJQ*l=u0M(NSal%Y1i jJDoHTs^IYg*;NS+YQG%aL*&*8C&SI"9u;LY9XTo/9:7Y!eE,;0iljWGfr"VX(Mod3qIRpR-o._SNnC( RB_;X_b75e?Su6f4.4VTYB+A22;D&ADrh-`6S+c8!JHAb"Y!BS$ppTd<(^Z7b2QNM@:FeVY&t,*"%<$* j0kT%@qapk](2s2gV6[<\bi'n2oS?H]] /A\9O*o!%,U*&%(!1]5a(W>@i2OUe#ogj+sG.H4F/o[uX=pSf?;eR`&72^DTn8k/KSe-*X6=KH1"hZB^5j-fEA&qGY6',sH?=a5JJ8q4mm)5\Q]4i&Mn!6G@V YQo(Fd"BA?oT^;baJ0Pf(29QRKEICeZXgYbI]Ejm4s7&S+Mfgj2h&`qWnOQLaI^#[E,".SI05!b6Vp]k 'n08fWpHAP9qAiZlB2Cb`gF2:)Mb\6N*$uj1R%oR/CNPa,>t3H&]&\QITf[m$fl1Ua>a^c$)h1i(VE^J Bsl%EfD*6/8CK(rL!ed.&td)C?4B)7U)Z"qi&KC*lmIrr$tI*dn6'CkIYf7Y`0B^#-rS4XN&j;K-6"c[qh(tN9i5qEK.%sAq;UuuOW`&R`J+H.mukA:29 bl/\ERJIl@n%Cl27Xn-jJTl?Lkc7Nss+W2ZOOBL2O^^D!&HdhL0-kutdp1@op5,&pm:ZpcoRa&!du!AF rX+qfoM]6Y-!9U;!!?!TIi&TK'VK"o&ND8]D'p.;+kou[6C(AQmJIOOhW1bWM$sY\N^NN&bnSgkBZ[j? mO6aKFq_!gA/FU5&_W$d/[QWlcY$O(WI-,qX4reA<=MuKOIj8[) <6NVM#-af1%@//3M]1,45E3!\HOFWElRB3_K."1^o)L`>XmqR7k1KuU>I$!D5`S\eObPtj&!ZuV"'+sa g2)s23L`'7!)9\r3lM]r+2&^pT^RjCQUcJtceqn14e+@PT[Yu?m#Soq"g-HPRBGTPo#3]RoN7*k(FKZa#WP%P_5s2aqn\1HmZ`:OjoVO-<5n:>_ME6#qg99iI`F.[r`^AM ChIdsW'0Y/65FLt/E>]nR8Zj3_0t_pZ?3'D/%':#X=Ruin[PO7;o"=CYfXRWO+>MtP=8/Bn?n/C`13!. 08_frVEpKV^Cc8N/hn".KU%'>#IV95K^(n6&b0Q5M8f-P/^^pAgnM`Vn8fG=H[^gYs..*>3S7U-/(I90 ;iDo\8,$qFgCps!2GGp-,B&rHC3n(:F04q0[..'jK>\cs&L,%0 D0?M5HA5g`hXs1mOJV;mH.&-i!`PH&S:QQ!-n`ju"D>4=6KhV;Ag@pXai(NbkUqKRGF0n>ZS$*4s"#WD 8*ieoY#="GD%S]F8;'Rlf8*q@=d=q]kdu/FAA>KYr.T1r-Z5s^T6?:_?Lp@*>^+a,$M-Ga?seh2I!jIK +c=@WGs)K+N+VRpZ*SOa.38a^gl+0VjLQ5)?2;h$g+))moc(hI1Nf`NH+SNhKe-T-,!mRb)'A1=bQQ^j849gH-oR.L+&Z[rqdIm-Tm:dn&Q^j /EOLhaLb8%#afoT!SZUio=:)mMIc<7b9f-#r%!B9[Yl[)S+g,8)'F1\6qj'`fi_t#r;F]79-V=U_mEXC a0Hs;31.NoC.CYBBumBXAh:X9S4AZFOkloa8+t;D>uf#r'cqiJ%47JfRCjgs%hJrnRQ^T(&"lNq!(!jh hiY`J,Jr1,Rd6PN>lda,f(i+tkm60u_O/"da%K\4isrp.+K\.^r:Qe3:;D\\uuTmO]KM&$/k(>d8U `P`X(fW]fmHHnEXQtk=M'#GcgG+]Q<\:HV2.@"/Xb;I=S9DbYTj5Z.;jGlSi7'*Z(ED2t0E0%ESI5n,! *VnH]q*"jTSklX&F5n>hN#N."bE#5L0!-0P&2TQ>Doi`XF`85bH*8=0p5H5[1X:]?)VT5>4J0(T+F riVXZfZ"jJg:F$1iC,b,DlSJ5;#V#T1K_#"Ue.ph;+\.Ej"@rk.2WdSAYBnY,-_O7hA64t^qE)Pkmnjj ]LRQKdgE0Krp'oeY60r>qObN*?N9T1H?UIR0o3TGG>BF.0p0:-6Wi/&3,K[F?$3l-K'LtNUnK^kQV$%3 Su$[>&ek#8b79A7FY7]q4a;PcdeW-]%6X?<=C/H&HM\UZHB%5HjO(Y\G:^74*L'?B,@JM$ld9#j^Fa5F?k/r+,6I1t Lq[*>2:jR1%k1Z(bF0VY48;t="CTmF0(4`$*&rCBMZdD*`E$A'XOb?M,_QIXmRV[$UT/!LEp"i6g%D5C :%oh$emp9[k2rh:q]]q,FCs/-F(YlpIAs:*FP)(>RPlB$QlX1GGe;Tu=SBOA<3;@9&/[/P-D/Nc%r7iX SMB_C>m8G=[(BO"IcjHICL1]mHZ^\M;!Pq>ZPH1\@cp*2+7G40%omdV(__VsY^h"&PjV]"!FI?B1uSs/ CJr`-L_5O5kqN$2U/jd\h=,A49WB*g.)?\6oEf$r:E#IL+m"E[YO!m%;):4i5H&.XUr%onX(Z=^`uT<% :`b);(nmmbEqO9kg5I&KSlbG"i':!6$g;Mn;n\%d#6"edmT5"53"Q1/!Q-iRc8Y*loE8@A_mVnWo'\:p 6qn`j?[o64Kqp]N$QHlCX/S+3DQ>ES-Z1(-AQ:k:X$L;LpsJF@M$3Jph.,>)G4/KM8,uA2s-Cd`3YXFK @`\lj.Xl/l50?*<0"[Jp;^VLNB0Y"0p^eZ2^Wbn-%mT27&:+@BTY=r2b;t&H>1QTP/#aTa ?P[/uL:dN/J%V4mU=I')J"jfQBYD[ 0rt\t2\6#YLm;25.7dA8YB;*\0h(5*=-[U;2>,^-7FeO7j?Qr=/a'GK1Dt8]qXm**1!Y;Dl&faYUQ::V r:&_1>=P_2@#3+"Dr-J?i9HU=U:A9JRNVMc;2tQ@^OgpJ,`]a`jWh2fG7*(KLI6/Hnnmi.=_6A.N:afR -#a)R?BN3k7;?6f=#_(MRRUAoB&rnN?W+/2aA_a_G5He-j`AjH`4Do/?*nNlf^HOS>EGoqNNS?Y.at]* m(gTERdfFf4niq@]C%7blN-4ICFiBMq\aaXm6`r&U`?pM9N<,$NNY\J&N[ hPfMG;'i/A+buBm@rWs,OK-nmg+shPhJ-F=1Ae'!(0/73'U;RX2LY'ic)V-eL(mBa^6QBjK?e3F?mG@G J[_e0kim=AIgFP#h4-LU?&9l'?dk/tBMK@ZZeb.t6/-_F#'6T=2k"cce&Tf2e.6M2/qdm'9Ll.DJ:?%S j4AXjbXpQCO3S5XML;n+YcD7inPo!U<)i:a5]5C_9M!HL_qSq0bOpQ8]Rk-9_XmH`1r$;(GZ[sao]@+6F:V9cE&Xt_eZBN(Umr6K04rgF'\-U58X D@4h51r:V'm;$U=N,irDW@9A;I&gc$92'\KM:e-Q%&f7j4)O>M4]r#?BcsP97uVaL+R@A(>l`^a8[\=# SGDd(d-@Ua(h#\;CA(aO9'j-UAqZpdPZ_$H^'ik./$"QQ.j?+Qgc+qeedN@%in%t>b<)DIN`V9B&>8pa !=7'1H!"XTS,>%8+tiTX&"fk`g0\_WpJ1qeS^FjoFAe'!p"?o^*SE9Cjh!&gC>>$%3?,o7VR='-T?%OVNf,1u<_b0C+8lDOmHmS\Tg/f:"Ft pA]2ZSW?9aAIB=PN_)<E!2 PHi;rRZ\.1jNtk[-ae28U8p2]Gs.KW9(`s(r3?0Am^N!F"G mA3%gV:gm#B?t>#FM.XJS#9l0;]*ee*%f(r11$2r(@C9O[%stu.5C[N1L=o0bfJc.c6Epe8kS9>Ye6fp k-HKs;f$,I,)+YCW/$*CLFNuXM#QD9RD>h!kh`3mVPYf_SiE^g$"E6uo$6;pd7QqVG`R.lZ3#`PnP*Ko bs>dlMlPi39'Kn`aBLf#dMuM!f4WE*.g@0b&dF+O1[a--`7+k!10JJaPSqrpA)m+2d(Z0a\+![E;'6(j =XY1o?RY6`>ZQNn(#384b[2Ql`MpGF.?"j(LTY5B_`J:O/6RPLWYF2GBP*WtAWCV[*Wb E.p`'/JYF_/ffM5LJCcM`D)ejoZcf3*NhOtAF#.<5BkU1qJHkqI8sB.G9EsN%$)FI(8Mr*=_Vk)J4'qn 6+'28-eC&FbtW*3WC_bl46ui"b]KF).>V#e9m9ag58n5r)=&80WVX-ld*_Ul"lMTsasXq'T,aBa:`9`[ d$;I80O6^H9n+;hX[TKgYog?7V@fRD4,r#U3CO4:1OrGHRZ]>f7kFu-JKCuqD@c3bcJP`)XEtNV2;GiK =F>"Xalg'mJh(5E(X(j6)kg$=+@p2D'D[H*`F+ak0S^F=YFrRp-OYCl?\Iukk,P*u0bD0Q^pQ8J3i#N` +XUaC_)Leh2,oqHNuYp^e^(q89pHK_L"NEh=,Xf_11=u%G#uf&B\G14V$Ti<&eA/j!F\]gA%lhGWPQ4 9s)Zo5*T#)3$Jfl?Og3U]grK^/X jQX,H.nZa:KMG_?6X>+ZGmm6=C8sb]S^J'OIp.8LeBL8TO#@)%H\>J),IFZ/PUTg@k.><4GuOW+GH^NN GOhErmDaJRp*\Klam!4H $8#.4/f*K7JtqIFIt=AKlh@[5eJd.kLd(tktUFbOTc<2Jm?OU\9UXMp(i)KVWp MhH+QG=HG[g_Wd R-/#_#Slos#>Xbpl^r)Z$JE>X%aV@Ys.mJLX\@WL_*=6(3D!8BBeo'%2HR5JbU_?O023'h]>pccFeX)3f3mi9iU=B4kl7og:9s/bY,Xg]&hCZe`&>n%:H<;T\%cO_McXN kj)pM`V&MC?1IV`(/\#)p=a8OM@r#<]sIqQ$YS\i5>FuUkp2Wlb2`tg/30dcC8m7",h9/D)gT\dHo'e] mDdd_h@ARRXH=P?gr*bAb4C?#TGbrS,F\`8?5:@D0FpLs<+1@p9ejlf)NB2"RR`na(+?eU-!pk#SZ4d; biai*FC*[f)?tbAQT6>rYdH?HJn2APrt]n6R?0'apZU,,Tf:f>j71@PCPcPPiKXNYnaY@_f./:dF]I9C]^^]Cp\CQ^([4/IF&6]U]FY e6)3.P$j)0_$"++d?u5H9.+Y_5kPpW)qD?KCS2D04BKcS>(EF)$b=7162C?')QeA]Mu^X*1>@h))"2=$ [$[$qXk61iU;%Js[4q9aU^N\o_]4\oKJ_=/nI(<.SpSP/=gUfY6uX,)_e'I-\F4"?hU0je)GBK_A?\Ro >T*Bs<2HYqdZ$[CRRUmMjmb-/T+P=IccXn'9]Sk9&S-bD&6I,TDeGB:KX&/TU3fkm9kMM??7kc:M6l#I >7rM5A#^N`-GJhaU$D+_7'L#9V>`%Tn"S; %_OEH[EHuDV6Tr8&WO;r0N;"kKLQ@_%uNc5[qul([JVl^S[0u6C(AU1@S&n4lhKP%C?Sk.5"![9&(_; H)-6Z@j9pgqS/^n,A<_6#qtl[,p'EkQ3O/`W(;XV]r/@Kq";jJIllF4?&nQ=LD,A`kIo`n5[839d0@NX #G@)*_4+1C4`:ik!T;TWGd)JH1=*.Cf7>()kBG(7:u'fh>%hT5O[&PO_Tg#3EC'eKd-]rD+Kkl\Ff1/* _\*.8)\D=*nl8Iqo]DPAB@JIi5/\<6jF!ud^bY;9"$JJm4+agE:pVC*NEE>/So(@U-u-nM?(o'M*b"MX kTI%YE`G`m]ueoi5VJL6E7qYa,nuX19c5o<7/B`?4dVp]_cbAs'+sLsBD>+e6uuU*2#J&hH!m;0^&W7? :03kfciOTT'4#Wg_#qO]W#=g.8UrLCJ7fr*4NHWN./U/+i7als6qr6qq)5+pL5DmGp-`fBB2QoV"39T+ 9a\7bmbP;/Q=pb*e4lCs3h%:eU9XZK#ZCaGB8u[u8-_!CI]*%4M#%Z1k5nlAnqPucCIN3KW.sK"ET=9B ?OcqS&2rJ9_!S6X)&@U$q.mr)c6VubYJ?ai=S'jZW>Ah>V4,49JA"NEKK%VR_5^Jeepn8VMO4[\bl#fs )([)tp\_6J.(s$b"C*6tm%\7g-@a(dVmD#^)UT*341OAELCUAZhr.io0YV;Q,BnPrr*/6iLR.2T91nG+ &H?U-UT%)fB6$Y,==k%`d2h?tJSXLR:MJ4%_KTNBC@ddl*1MB6.s&aRre[gsUPsH\QZ% br5IpAeFMnu&-1.48d#2RXT*(J'gPRXC2LgA4fh 29''bg6a5%&d52ba.MA4g:*Q[3kC.c^J_H;qtrq>+q7#@nR]*0F0>/k(2rl.oj6\$k5)Zh/H5CW^KGA0 _el<8#fGVJ-YHBaM2k!,pZo30qsIfCL*>4hr[!Xk%ZOI).6<'aF4p@Ajh7KeM#0Q00gtD'b%oaPM[fA2 n"6&=*'TJ"F>"'4UiaR(4EN)98?(M*m(mauS3GS=]h*V84k4B:>e=/SEqI`Eb8YUnY/[g2m?^\n1/E;q 9N#D.`>@69'b&pc!!)Eh%&`I\-CP.Q#@HD"$"M?gG1!=tn*H6gIKHW4qH>IJY"f86>QV@R>Fc!JbV!(b XZ&[8Wk8tr%KHXt5%YKln8k6+[D7fGDXGaeaRC1[VS#K=*o3nb%6R/K%4^C=p3.SeEsf#'/6[:V+QOX% p(6ggPsfsAn`t@m68>DQY8@7Z9'YBeK@\UapWQr67_\#b$#t7tS/o-J5I6 o)QqubR:i7 C)%=e*Atig^q%-"<=>[7m8h4YK<'t&:1Y%C^!e_'T>8J$NPD?V*?#K5Bh:gKOXR'amS-Ef_Atf:@JL_D 0Se?TNDu\k2$[8i@&-9Y98Bu>MpN#8qB0GiGUB;oCr\Zl*c%Z,7?#h66AJYu81'lIor!*J`'jEr2%n1u eR$^6%XgWa6dD!XpR6'\ITX"Snrg6B48X6m3YPmRBR?dSBjAaPH)'I@_E8eJ2Fq?,@=TZTVEqtUc_cKE WRtl1^BUpZlZLLc-JW?lTR"WP80%E.6ULV4p0S\CR;VA&dL"MqWYA8EEHe;Z>Z4mDbr:!)_ofb&lNo`,A1)ChJR ?k3pQ-40Blo@j,YJlC2%4h0PD,i6[@.r];GgSD]tMcHWjH-@74i7%Q.$!kZWA! EEu5PqNUV6(#s7"Q@#ptc"I&h_9t'eOsYs!Dat3d38+3RT4Hb]N`/M%MYM-#$'`P8#[("k4FR+t0?7;( i,3A]>CnW`Ag3K.da97N1_8@.=Z'JpJOI(B.hi^!Ma>HC<.8]:Vm82a'/K)SpJK:_!3<:PGGA>&\9$K\daZ*/[\/g]j)b-RnORh993l7L5-`_cB)+n@FrGOX(V8);.E\cGKs jscN8_inneEV_1>;aejpF@*Q"5,)HXJNLAe"i]APn(5&M!uje5p>>$-prqX;MF^D^Wip:I;+=.D?f!%2 Oi@K6[@"RcIoEP_HR5S1!"qr0^!Ok6;HhCD!YG7oK9bL2O]Q-pa#,270``J74:eNCRCET70b#QNR`h90 GOWW-`Af[2#A1s-i]7M@3%Pc7*W-UhZQ+p5t7a!3mF!O".3Mjs2!)Dih_ #."["qTD"j.0/ralO-^1nk#6&kAp(YXQW#4IiK2POJ-bm?FN*g,1Aaa-7(GC7Sn'bi?4 Ipf+S_`8TJdu09@bUjr<,kCM(B2i\$Cb'EJS`"QU<0lZ5S8K],1UDn1pQ:m.fH'Tbdo#qB)q_\Y&:3CT d#4G@Jj9D9^-!q[X`)&7Lri.d>\?M\AkYeIVQn)GV\6N*9\3;P(21kLG3+BmK9pG[q72.`K!!@4h.mI; R6rX&PR$^VTqX'.1H2dVc.j*k[4Y/C5osm)2K_jD.-?YPQ*n[8450liI3JTdB:mKmSqh0>m9ocPOD-,cM+Kc'>* UmAFu?7B[7:[>e/`F0/`TpbU[?!<^Vkj!AX4`%Vffu3!2PWd(n6'&/Dm!<4h7K1U;F&CRr6>+4Ca3-P# !4`c6f5M+<]t^VN`AgD9I,+<\I.jtU<"XREOZRY-4_\XtA(F=<%UfR\b_q'W-i'q]IN`#IUniP1Sj'pO )<')gNRWP'BEPLR@KT4'AWBMVb6Cn\n"0sXP/JtU-&iH+&o"EDmhII\EZ$F/KFnF.Dl1]tVq'=Hq?!h3 8ct`O@RKHMc-PZah1mZ0p2F9#H>"A=mj:#s:k50UT[557,H+YqQ-VHPF3Q,%MN.EL6\Cg*dK:i-QqJhDr4YJ:maNoCU63$(jFuP("d*NO+7q#=^TW>_X+_QDd@(p0o=cC'(UAVm+&OC\H'-5:dck[+uL/VKJ?aG.9ZnJ>%/1f;i*B*]>+J@Oq$TeRsp_Z!!SolRK3EPueFc,'g,qJqNWh"(Y]!C^YjeD0!G$+cKat5E=GD)u^fSBpitd4uD=nuBTeL"[htG=" c/*IDe&AR5RWn1sbEbNhGl#&ocRXi;1!!iA@=HL^LnKK7CU9"Ek0G)*co\;Q!B':p#c/W%jWUHe^pt#, 1d$cY3'!IJc\>H^jI'iWcK,b%_TV:+7;YUZg<"F_E=En*2+7u:^+%p endstream endobj 99 0 obj << /Type /Font /Subtype /TrueType /Name /F3 /BaseFont /CEMARK /Encoding /WinAnsiEncoding /FirstChar 30 /LastChar 255 /FontDescriptor 100 0 R /Widths [ 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 619 1000 621 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 ] >> endobj 100 0 obj << /FontFile2 101 0 R /Type /FontDescriptor /Ascent 1000 /CapHeight 850 /Descent 0 /Flags 34 /FontBBox [ -101 -251 1000 1000 ] /FontName /CEMARK /ItalicAngle 0 /StemV 0 >> endobj 101 0 obj << /Length 2024 /Length1 2024 >> stream   OS/2Ncmap$g-glyfc"head0 d6hhea $hmtx!loca maxp. nameC!npost  @ TUT" Sax    " & 0 :!"" R`x    & 0 9!"""UUNZW:](6ZWW\]UUNZW:](6ZWW\]UUT47YY:tU YY " &_<_z_UUTTU8UU f    %  3  ?CEMARKRegularCEMARKCEMARKCEMARKRegularCEMARKCEMARK endstream endobj 102 0 obj << /Type /Font /Subtype /Type1 /Name /F0 /BaseFont /OfficinaSans-Bold /Encoding /WinAnsiEncoding /FirstChar 32 /LastChar 255 /FontDescriptor 103 0 R /Widths [ 296 352 500 556 556 833 611 204 444 444 556 556 296 370 296 444 556 556 556 556 556 556 556 556 556 556 296 296 556 556 556 500 1000 593 574 500 593 481 463 574 630 370 444 574 500 704 630 593 519 593 556 481 444 630 556 796 536 519 500 426 444 426 556 500 335 481 537 426 519 500 370 500 537 315 315 519 296 778 537 519 537 519 352 426 370 537 463 667 463 481 426 444 400 444 556 500 500 500 222 556 500 1000 556 556 335 1185 481 370 778 500 500 500 500 222 222 500 500 500 556 1000 335 704 426 370 778 500 500 519 296 352 556 556 556 537 400 556 335 556 444 593 556 370 556 335 556 556 370 370 335 537 667 556 335 370 444 593 870 870 870 500 593 593 593 593 593 593 778 500 481 481 481 481 370 370 370 370 593 630 593 593 593 593 593 556 593 630 630 630 630 519 519 593 481 481 481 481 481 481 741 426 500 500 500 500 315 315 315 315 500 537 519 519 519 519 519 556 500 537 537 537 537 481 519 481 ] >> endobj 103 0 obj << /FontFile 104 0 R /Type /FontDescriptor /Ascent 787 /CapHeight 669 /Descent 213 /Flags 34 /FontBBox [ -101 -251 1000 1000 ] /FontName /OfficinaSans-Bold /ItalicAngle 0 /StemV 0 >> endobj 104 0 obj << /Length 40888 /Filter [ /ASCII85Decode ] /Length1 897 /Length2 30481 /Length3 532 >> stream ,p?)`/OGf90etdG2'=V63AV*j-!!`_F(&]m3Zp1<3&WK61H%0L1CYWV+A#O"+AZT]Bk(jp@3AKW DK?q7F!+m6FE1f#ASkjrCERP-+A$HmATDZsFD5Z2@;I&cH#R>,@:Njk6Z7!aDfT9.Bl@lA%5BR[A8,Oq +C\npBl4A57W30d8T&-Y+>GPmA8,Oq+CoV6+C\npBl4A5G%G]8Bl@l3-nm>0/het5.3NYB@:X:oCj@.6 AS)B):2b5g@q?c26Z6phEbT0"Fp[N.3NYB@:X:oCj@.6AS)B)BlcaXG\(D^Blmiu+D,%uF(HJ)AS)B)8T\BWBk'GH B5D-%0Han;AdpCnDId=!Ch[cu:iCDhFD5Z2+>#<%0Han;AdpCnDId=!Ch[cu<+ouUCMm^)F!*=o+Co%q %:sEf+ED%%A8c@%Gp$X/AdpC_Df0Yl@;TQu02H1lBk(jp@8gTPF"K^sCh+Z!AS)B)7;cURA8,po+B*Aj DId0rA4:BGDe*R"B-:_rAdpCi@;0V$<-`Fo+>=pKAS)B)7W30d<-`Fo+>G!LAS)B)7W30d9jr-aBm:b) 0J5%50d&.m0H`&%0JG4(0H`&T+ED%%A8c@%Gp$X/AdpCnDJ=*5AP#941bg[A2'?F@AdpC_Df0Y`6>q*q /N#C./M]4=+>GT,2]t+=1jsCU@:X:oCj@.6AS)B]F`MM6DKKE'@rri)DIa2dF`MM6DKKK)Ch4`#AU%cr %AlJ$mN!UH@X:)NaA4d?#2(X#MLJ3XWqQ9P/r+Aj1,u):YVHXIIC@F5#"G*:rr<^$Mi!-=19qk)OXl<;?PD4 U>10h(1RrN%sUr\ZgZi:$W6]X7$Kb%iVLcj*jMfB\K?%F5jKdY?4'Qd!Sjk8O.hW)B'3^""Khg#ZK_.H M%O3KP_L\Yfa#S$d:3OV'G)&(L]e"-#50OG&]OJk'&eFr WjQ=+:>:maf"8h)7;(+>MuVblQBBsoabV87jjKI.d!1PW`o;+S7R;n [uXKAE_9-@-+!sc&q0EUrcsW4AiJ@AdW!":,puS!c+k[O"Jo:^1Uj,Z"8Qp?n76Ag>`_9q5b0Pr$(N*H (.qJqUsLGkb=`gQmmPTbKb4#W/nGk/L(jD.*&cfaP8+]);[\!aGVt>m\hPbU5:rA9[n>B!Ps.)o:dG9K C(,PgE3d_D?KPgFho?R72NNXl?&[HJ8Zq"W1>J1NH$C@P.u9'N>qcgLLAso9eXf_22:4`UaF1EOSZ1'F Tnc?Zc8B1&^^Y_2'U``rGWckK)`u?o-hKFNZ/A6T'Q-5p8j7GDVZ`hVf=e'OXgHo&*P#m+L+@trFL4D^iB"S?I%$jd aH6n7d($dK\2Uh%KehX3fTJbRfGqY!O_YiU\37#GSP/`Xe/nLFQa!]3!Ocb*H3'a9=C,upI[L\pm*I(C Rm_-g?9rI$_^G'Yl_hMMe`gh608QUf=Xmeh*R`R_IosLmZPR/PY06b*g8=>Ss.I)?T+5N]5-979@0TKP IYUXn5q2e$D)$#?Pr6"FWCFlcN(Qe?X%3Dc@;gu4g!W8]2t48A&%:J+llL1>N9%3g0qjc%P'31H4qafZ 8Z_pSl%A-a^AQjoV^,EFEdbW>f\?$S0=kBun[RG09a4[e38YI\_:$D?.b>]`CHtl*f)'`=-g%]2YHU=MnN_KhlAJJ9*kc(kV2d%4 ]DN)c.52Ah$;tc$?@sZ$,*W"S;_II_d%_J3ZfuL_`)t.,jFLWa.-a0a_n7@X1BjF .sC[6K?@@Z2NM/#`5\R7/qF2m&VW85QbUgT^Oc+0GOOds#[PL$mCIGUmM*5>Pgh]"F8Fsc^CO%bJd*'p MZ2=jeX];5'EfHNj\0\\)?p)F6Yb06m&q>M5(\EX8APNWCS"Bsrgakp'+,qsS?,+2d:>9sG+Bnh4:!o)sf6F7*dJVb;)[ aZei^"CRe@$426GlQg:D^A=nqYV05NEsLYb_R%hWDAt&Aa',>N*W,8\FLW0[XE,iil=,'\EMh-h3#)Ab F*QoLTis)Vi,U@an!_[H8([f/+4[&9XW>1F5I0L:?+M8R[LPk5,e>+3_B(g4R,mJ?5i8KDTZ?,.7^Bdq r=lB:c=\%?K,CA3:M4QJm_F7:HlMn!8u-^1D"Jrl35&0rn9[b%P(Y8#``CP7U7d`,e'4#N:Lu5W:uWQe\@-]rS"!>jWT*J2r,$ OMB?W_s6/!/T[7$-W*NL*.jdfMC],O2KGEI/+N-XFcgd!Jb&WbYbp9NMno*%r.PGVWr@N!l9nGH<>Xj& H\6[;WGbUCga!kLfZFu@VhrWcT,UP^C@Iqc ZT'M[1qDXDiM0m#%uNZ&N:g:u!n-)j g7S'`GPk\=@Yln;6kQ<6[AY*\P.C_Qi?clIg"E_&H7qS$.?uC?aY,]@lp7mE>W6-oD"=m=QiO RJHe,o3qORq6'_k\Hd,sq0@oMpc+ZQ,N*kM,c.aWcF]ITJJ[$-gS7')@mc%W`gQ,FgE99:lo4OC,>@.E "oDJ8@?ZsEFT=o)!uQOPM;mmn"?P<%X)1i3>45Qm2\bp4%rk"QRKB^N6)G+th0@/m=BtW4O#FPc9Dfm5 9KI!B`*nVFKMn#'d%#*M2Wr-<,86g-a1N;ETf-^BQj#FnLDiuWTk1_O_( :I]W>VtQ$V3[c"4bPttm3Df8:fM54K.C '[hQrp6^UPF*[j&HWb>r5lD0fJngOqFe3BoD^]1dJ-66ea Dd0eJ]UWq-[srO4PXVJl`!Y8l:&$WjH7#sh_,-1/Cra`m8lTYrT3+!]EH>$GrP=Y84\8BSM4jB%S`D8( 4qRsrg3._UZoPMi6Cq<#AN'6g@l/tXeO=BSFKjZ7?N4FZh'ub3NR`7JZLeBS&(j)YA+M$9p>6Jp7"eN9 (LY4RHlWa""Jjrm-YG14^H;_8fa]E'c@"#Y=N8([#!3#$ggp1();Ud'2MA(4^ZZ=>*so%8BujG!fQq%2*M9O=Z7[oLp4:m[i;>1IHA gF#rFF;l-VaSTAt@%r90Ure>NX]"*JQ>C`F>Wk#J&h`ZM.aca;[Dq6o4fRA&pL^>[cr/l]&/8rn:7S'H `,so3\)]Hek48#)@3Q`Wi4LkGW'PAEJDFBfj=taTkjt_M]6&k>_p8S=MhB8;X[k\\TNL>LOMX% oD=Wrgd=sNCrLj6.!mK*f>$S394s`_6%qfB@1=:0Nk.d7!o6bJ`+'pg;%qQk=`4L)X1C214sJbMCj'^i WRplR"\cUT@W7Kqe\V6FK7!so]gN;&+C@,R&E]QKOUA7'o=C:JiZ,=JM_E(0Z5"pHTN`TWVSEm`f!b)8 GcTg.;3CXcBr]/!UP!j"W$k*]Z1_Anc?naKa=;!ap:Ng^R6!sNs-kpIp;C%'F*S<8`0ON;=!#i%n;P nugK)VFEY^:JI0I'!XufSW,\%!tOII/qjhKN5:'ob:?hNK7m."nViAqGuNeEo`>T,q&DZ!`!BFb(6af8 )3M4BorCm<.XLcL#A"uC_XX#05kH]@dPfG:8QM-.t_d3Lp*^F`cR ZoK`*FsK-/.+l)M4&DIJC92H]**d$J(8l8"/7S5!r>qAm3)XN0jQmU_Z/F-@daMG8'Yoag:;XbInr:R) U-^d,O4t7nPcR>t\cHI%A]Ijsn_ 8$A2#>t&(+@#3CqZ E2:;K%$:Quq$F2nJ9651j0n2>>b-D53so70Hkn^m!=EbiEMK@IO3*F7AsVH,88bPC(YM]R!:8MInI&CPji588CHH[p'[Dr:H3^Toc@`imf,(d]5nR53TS$\3&7(C"`:j/ME\PC@KPkCc9=&B^kaMs)T/4E-^fP+KUWV SFg^6eM"M)hRiH<(,NWMd$aU+Fh:Kojh(`6FmJ6/IodqTB[ftNJf :l^tmP[&1?8pc)3Gb,9s.5,NrQclEJ2$Tq`%KAs9._IV)&]#cOo%Ipl$gSk.U2%=U_"?\tYb:LP!Ff0F QonEI1=f.DlMSot%@\>jP\jl'GUiR/@u8Iq=-#0mk#T]qC[t7pqM=M2*E]TO#&iDhY3A!YcstMG]!Qlq NU=,o.oj;5N2dnZm`sXs&3IcZEVIY.4601d"A)G&2Nuen:/:d84!@DP5qoA#OX]kY6S@&/n*^0W+8VrH Q6Mu]d"ZCR@:NEU(Hc!'rZ[8:j#GBHoaLBPr]j<`+W!^N(*TtuX/F/uHgS-$3%i.\e0FbC(&(:pWLVL1CNG p>q;oYhI@RWq.qCVaR>0D?]M%JsmZRYX?#0F;!Mmd,`K;nU_ETB\?*oO/PJ:>07f#[A' L5n5,ZopFD(@Cu^4ufrt[tU6]Z!%Eg.'p1/5Qo&R4RSOIR0Zt8!%IHYNI+3c;1s<5hBkk@%pV4gHE)(c U+aT3+7Uo[i2;<.[lP@brk0&"Yq"Lhlq\?:.V?9o[sN!KUVb#`!Qr1i3rkIhajVZn!Ec"U9OacDjT,"j E'b=>kL&.\?0&S)5bjq6&u8ZP>.cEM+nPQmd2!F6MOYDMB[lE%9I9=Z-X%"71L.<_((c4&>LQQI1*8?W $0g^@_,rs[PUI-Gcsa!5b(GJgTi?,@DR\e#&H@SU.&-Xs/@m'e6Z=TTQC!=AHV[Xl"gNq!*qHjcIW&<1 n!6Ed*q92`>`$ug'+)atI7T#D2l+sZ9)N`Yh$1rm$m)BQ!JK?jpNB?uHlpPd,+$Q7,9RmjG"?6Rrd%([ *!,Wd;lIk`JQ#dI Ag.U)KS%YG[KUGe^(T+p4u0,UecIS)LhDf;>ia/1O#V$`)F>8om4%_JiSYI2rMY7uJP\t*2/5,OaoN1X "eU#cS*^J6&;AMg]T2>tOtPa==A0+-5Si*OeD2en%7)p"@Ak[I#_kZ"VoSZqu,=Si9qHV-#P,>Pe3pJIaS/STau^ur_%N/#qXf#Wjj?YOKo"F?Jn3p094\=Dbdr%P+I5JooagQX)hhOP/,s4q!T7Z*#1#eu-dm_C&d-A&g&PL6OJY EH9n=9ta2_7[G\WVkPoo/&e+PSmhKB@1a]CW^%+o80SU.[gH&m[W(^@jQT!9"/gSUNVW^7in UgFEj70_,[OHC]PVG&\<>@.R82X(qW!ncB+c1nHk$94?D;@juFn"C&)Q3,'h5p!MIrp=%u4h2oYE8:(2 gj`t(Hq:"FWZUD#,35a7^-MbD?luI#4$40ZXe"2^ b2Ki^Ua!F!hW]h\^9NI5-a]@j[LBDoQH'19'/PUL$>^FVe^e3Q,n:h,?edCQ'rluIafnbF#_?&sk+A)% \gG/+nCG[1/&o"p+[X!`8XTUU;KR#.r%QT8W>sEV!Pq5dhR86:Vj'GDXWq:]L[Yj9:(OZ'-Abj^6K9uG FEHCU9kqMXJ>e&0gnM>NUVhRieHKUOiq;WJf5jHI%3 1p-<"3ICWfepp(Zr%5]\9h)cqnD[q\5Re"qVDVA]n)'kGJ.%NN,Ofmug!pmJ/_XZR1[K$\f08bSf1JDM p'IpVlrGf6EI:%Zd-&DGL9$8oS1J(K*Y\;lL;]HYa;e7AA-DaD0juX/hjctCJ'rYc_+64bb5)8uIMo&o _$bej.`)>(1ZEb]alAMWG_:W'mL3eFAj&pg`mbfpHO:#rKrNe>XV0 :iGa[fi"#t`XDqI]h/]'&F3q*!W?20TDj854h^'qSc#cb/Vh^.=B5TPX>#-:,2Yf<<=%)@4`!]5po2a0 +TpAr`:=V]D_EG7VX`P=dR/n@=Fk%=gGV^BaE^G5!3k[*9_?'M.f*H0HbtViU-H*c/B(S6 d>W.E0V+]L1br/]O+m:ikFaggQtDjRMtt=8'O\f@1rjXp)+O0knf_LjEX!sAe!jG#o-3eEcb#VY@E*S' Au-/f[.LemKMN&8q7]";'J=b5CN[&d+31\MO,12Q(IcE8o!DWhK6X[f>Rhu[6S m4/t-Q`5c7%1Z(F.97kLg:>bWiLj]*rXL6#.lF[haV9]9Hr6qAD+NLVc4Y(_R$an/iJelS9e6K\pr8dI 7_*a_ItUNc[_^4L_?8]sq1sXreq'%[GWu,8i>DM67R?BgY?R<+-%BGO0D1kg)p.\l`tRMK>+Pge7-"BW Jid[8"EHd!ib7Z\eo\C+7<>me`nN9 q>+smq>HS^d`AVcd\7tKq.haPHVI>49YH@fn6[2hP4'b:DSF0j*5`Kq6HY_-NJJed&Rq'9JU<*tl$UGE 6ktSgh=Z",h@:Vu-=*[ZX7oqqRPCt*IImlQ)FeEO)%dR#5H`hR[E-jLlfod9Z>?V.QqauV*/[]H?UWS+ ?cFF$cZY^%D8L3(rXM:F#K==>G!e^dlsBS00V"qjA5KM)@=XChKU?sni:T$>,C6oWmX'=s.''Cl.l(L- :g!_@>0@6pf$P'UU;\M/+;gH?=Cc,Y/o+^7F-Kl?[q%p<ei&Fo1ra:/uGjj>He7+r&0jD#gE&P(4l%31WeVQUqgbc4C>2G$,tr@,#2=-jku&6tCK9 ai<2fdn)$#ja.cCpS^4mB+%$Xn_\d@A(UC7g(f*Vdl*(TY`2:A^>8&U`Vdsrr`0:@a3e:h5ZgqYVDJ^6 AZngbB5+r1Z+gR6aq`Ur9]9+8('MaURJp^:5tA]nghXYX86)cFZ\Mcc*d6su5W\*Ha''*5H/ Y\KGG$Ag%dS&FfP1_^1.%t%Fd1Ll1SMQfmn#FRt%42*^\6=?i?J<$.q0Hnj)5]%2Aoa^`N $e0p\^sN)AiOX=/kK7Ynjh11*2\:C;gFQMc.,'l]LFV!/.mC0Io"GBF=4mF6UNr$:grdoQOWD8qPRE1r bRt/(YH[ZHB:4:Jb4eUr9QQ%&lnU)o!KOA]Id_G/m2p Y[ldc1R":D&%V3n"[2O0ZO:.9\oo/pFNP<04n:$]c.h?HkL2XJE]LcsFI(lDt.[3c__g]Xn]O6fN^#km(YpYn(\2M+g`n>nLSC!Q!SZO0O"Q6QJ%\i+1Gc;L7R+eR\ UCJG(5oLj$&R8d8iGF)?Za=l1^O.BT*g7VD^,TsjQQqWIAP;I(KRW)k&7"55AtW,]Ec`:t?9&-!l/<"U :b@:KI7eO,@@S[l8A>9Lgn!RHrWQ\`#2W8^s#p6+<#)P7J=t:c<<;9d`]>6/E;q!)SOXC2>"f.(@Jl"-+),VjuK;i=N"r* 8@"V75J-_JZ+R"%P)CjZmqs2/+:fpD9OH?Oo1V%7p/u6W!U7>7!i-,_#Esbkpfe"dUP'co,Oc1XcZma[ Kq1l#=7gKE:hL?."h1fgB\f$?nX72W4=bH,"5ugpmL*Uo\&Z%0qT:%Qo6s>D+M[tW5'RQ1+(8SX.X o2<3cQ2B8rnU1Q71C8pP^RUGP$M3\jm[03`KNI.^/hpfkajfJZ>bn1>-SZ%f`4jOZ[3Fh\C`G#3U,aqra\I='6h<3b@P0keDJ< HD=?<[]KMT'EV93N`#nW^XeOR8^7_k<+tH?BG#6BWarC1*"Z]2mM'_h5cBK+;1;-7FXfG;=+?pkH^r?GoM&+Am#;,bSD r)Z6WJTFEj+C]jC13W'9h?faU;)5nW !X-:hA`s's]=>"pYff`T`jclV'`="U6?M)EKgV9\8^5(WpUcYULSbBj-\O`H6)QR'=GR^&-fD6,9Q%S* Fbo.uJ$FX58t]P-V8NpeO;gGNHot+8r<&94=rJ+^.Dd-cFf#L^]RF-[KFJ:qCXd6MR@NX88a'ZdGV3j> o2I4F',fY>k%eeK=POsT2i'M)88Y[T;aQ+O=X$?o&`3K[Y_8sP:11!b?=)QNH-&VpCV4HGq&B9RM:*=R (6@t`*X-p+gu\^>RhfL9Zur?A0D3fsS+_'HX`"6ds[+Rd8c#YnAW'"4rk(,1S@aKL+ 9a)([[,.J7K-:]Crin:tO/cXt\TV6.\"q/n%eSm/bY-1cJ@m9C:_$o/g(;t/]_q4*Kc$p=%K8(%JV8/" FlNN]i)c+?!F^'/o2J[cM$/I(W5bRfT#GB0mOIJZY6?:@cps'u]?gs71EUT<122S]C?EI('i$^pl7alX -NiSam:P;TIZ\n\N\tiBc-bl1gsV@mO@M0sJ$I,j;(ufO?EoNN(nP?t6&]7`&"JFfHC>Ac4!r`PuVRdF086k>a2Li]&ZZ,JtYNM(W@6/Z**X[2[4'SsMQd FsmImL)N;@;h(+,5g/DsBnW3:ZbbDWNRZGl_&8,s$J,<`X:]dal)@K,7N#CpO$'hcm^fPuX7-X)jS7.3 #B\aeO*e>IK&Q0mc(uVYn0WR;nd5%rW([KT+@oB4j`.VKJlH;9epp#=2=dW26BG)&j%iISOSYlJnl-D(5TW6ci?_D>=$%.UStjDfjdV$c2g6i/!B't \R-OZ(^Dt6[0kk?CgqmnO29f"8].[&iZkY-cnT-=:e6Gfc-BM)XlU0052Q6a-ai9uTB\(h1 &F$ldABFH5MqF/G#0?utC%IlZ5u(l[!b@=u7LO:f_N'Ss(ru!\%Z?Sb4FIQQB!b6Xk[92;a-_i?/X*qs #o"F%D9u?QfApED[T/MT"qo1;WpHKO(MN6N#NJ9^!5I:O>BJ8=(?ITJ:r6cKF2c80$>V,-OI?Tq::`C9N ;ub,0\A"a.]6.K4ZG-(iJ:^0bjj=8R6WDaNgjD32QPSlQSD$K==N_g&Jt:[u,.7\.Hm.&e0uBOJf,Okm?,Xa4XYBlX`t(FP7)V-fQGaTgS8)#%W*!f8.GeEN2%\)u81Cs5Q(& AN5DJHqFle(VTnG7Yg9*q0NjV/7[$Y`AY7i>XUq9)-n>O/qk,D:p-i6ZK94?4ea^.W+nfdON`a[)AH?c QU2HH]'C4Le\Yp.4CL9KnGVY/INQV"Cf)XV+.L9^(+qXLaj7"AaqIpS!Ga(+J%3q'3$N@a.;b=@=IQUDpU*0\#:t/P$3X4B46A&f4T0j5AFO(O gkO-9F8g]R=p3\=LO!(#Y$*("%th!`014$^;amrMZiD:()eSYJr^RQ#efJm]7)H'I>pA]aUB(4Q?17N: ]3Z0pn=YD2\LMWg^]8.c6_iE@RaXBLrAhP)V]S7[L?/Q,j][o3n!n-VTH.RhM/7%39ejtbq"lGU`5;8$ pIN"rJ:it/:HU#%%h3ai'd9,7>R*N>UhcY)0.7KS>X/Sa`!b%?,;k/QN296ZS<0#gVSCWnJtOV$-bX_t `OdWqfKdd@>>Y`a(W\44mI2qZ>u?67aCUMBQ,1r(Pt/6od4@Wh.rXbM-'D&OCJga_iom%0]=Zt=Pc3#S H="eQ/3o8q&2=WH0,$0Gf-j_tD3iVGkA<]=fi(%[,">EEWd!2eqU:($A>h i4^n_97DqTO91GVVXn"F,+AN^!]r/#C@9oU$dIr#'\rqa=6#\4dZ+Q[8N]T;Spj#[r+P(kGR&iH$Q^Pp 6Puf2-Le.Dg$_I,qY>-+qjGaU0)Xse!tQ[eiFtSen!9QcC`Yqc)b_fLBVVgW3C*VtBS#tdW2$UR;[U\] )b)6U.'$7,O15BCPV#)EN`FLeLoOrVX7/G`'Pc+C*H5"BhJ'OBbArZJm16"3dc\i\>f:Q`FHd ?M-5.AJ_->j&QO>0ck[+SH.U^mlP\N>0;2lXlmpZ4^lC62l+$SKC>2.%:$AMEXX5-Z@SmMborq'e.Nbp b<3[gRn/h[>4GJP\NES0M2KI<7.'X)Ch'S,n!_@kF1B-6<"+Md1n7 \gO)f45G+7jYoui`9;PtRBApNb\!Ti1Z/]$re'M^m4V%c@L&n"hiIAWJI[e(J1YetNkT].SE:f8Y*2>(D+G+S^h#D5k7YBL8q%5%UQrNY=.K!*]&+7GqXrH",F]KBTX-nN:q )"T)87bu>^T&`qQ$\5Y/:[J1`b"()1-pQc_W0_,p^>&C%IOsQUm1aW'Qb&n"m(4##8<'u07e7CkMA9au#Q2DdaO&r"[lr:mWeSS`.dkr$=>$ARZAq8J"2(>,b "Y0`f0%jJA=^6iG5)LZ+c_K<&k`[gSHjT>8A]!NP%'`=N6T-*H926Yl1fm4I=/p@m ]lRR9P7H#U5%#q>fgi:RUkRQ hKL4ufj698k0(ZZ*XjO_Pk#r4;/dn%rqQC*rejEZO:n_:IAHrJS^0232/=qW6K$#R,q`WN05Oe&Xs^.D =kkJ>JY]WH_//BK#\!QLmVAG!r*<\?sqP0_h/n9B!h*Hs6^4=0/g5/\Tb?mcX[Q/>i/B4 F:rI+/Em in-H+eYm45m:aJPNic"?E+k7bZ@nq:$sEd.Ter&V+'[fF&$>UKR)Us5SnlYR2&,cb1aD#]p>4X)]d8!1c r1:%rj8K1DS&u80\2+V+=R4TCYMkPO6kBA#MIL@Cj2&7%6PV8A?+G4Kc\f,6PJ!2I81b5oO98rRM&1_T PYB1uJ=g_Pb[>jGUJdq49:G,nIMcuPBR>=@F%OSj=*LbKH*qK_W#+ah^!>N[@ L54T%#Hms-r\B\cH>Yl1`$nOJVK)FuGQ8ggLB\b&r]70!o^Ua>I8SB^*I>.XBGNa`0mi);)JR/ljm%m, qskbc6dSZ3hQJf".CO5N2Hk%m_,L&#UqR6BLj9ZOMlYt";L!*CaF+e(Fi 6Wm!&I*KR(CCb?\*-<*KUC9j*U2Iajb.)rOXo=`92au5tG0h,hAQp\BTL5ImZ`P7We_taO.ho%2O\neE 5c>8sJ'B8k7_s7jX#otr@T8Qnss o0e\c?X%Q&6^?NQ8^[n=;QWQ5G3V9jRr=-VqQ"7X7%pW>4pZ8IsP)nM"P4+K'SlNEY3s 1@JN^4^nSY1[o'tX7:Yg"l:F2$p#J+1e.\d%HA)YWgd:hPF=/ipT9&u7Pg8qZU(?#0TUhXc*:n6dur+R A@=lFd1T:"orFJ1J]Z1$F8P]^r#544 Z]A<<[u9US&sa2[bVd$L.$SU`LC@quB\4\HC.YgbBu;QUAR!`?T_Ti(@Wh&n24S3%[jCeohSceHES'2TLM0@haG`YJ^3>o@pN_J$QU9X _)M%_ltKRiOLsRC`jAhW:P(.b)RA_;JX;-aMVE\*:m64)R&[_+#f[49$X$2WNg3%LjYQq-7S2&(F?JDg S1c`eI:QTjDA\CO5.Zg?JXGA@;dgp+DDAXMs5:RqhPV,G<[\#clt"4"hflD&87,h9r41fWIX=iq(a(3: *V800_N7)R;'CJ<3W@[k#0#A;ruGU;4uWNQF\tWZ$3l:cU_g)Ie`BpY./6TqVS_`uc*C3c=b(]q&]JGl (9QYq@$`LsMH=F=-&hT#'bPi\li;h!1WOj4eF">[k/TKEXAhE+/Mh.cEotm6ek8LYo7&T6__m.+FA:cE _?c=IEV6mD>Fu7F(RK^_U_=A"r&`;5ZWUheV,V'-'EsJg%P:B*On7!N!Qa(#5"(+hU:IT]A*8WIe3lkK H\6ccXd`+Diq@m#Rl;lG/%S&5puj=q;9@_<6K_j FQ-C%Mt3kfV.P`^mR!H;hcGfI@^aRsgD,+C$@Q'g%ts-d2j@22.p`Ld5(/SYN,+]RZK-e;p+gg*>*1DP 0Z"9$J-kU)Bl^/1BRn-]o`@86adnO'm.MXWf7S_V`E&Hql1+rAj1VdH/e5h.4ddKJ6I"UBdL>6t31 #hebZhH)jbitKTkh9\s#VGgp"?F=25c8bY:RiU^'ho!5:ioK5#F-pShNZ=tr%'3R'j6XW55+!*gRb#'g 2$;$Ce;P][J&CCbGR"B)h]t_a4@r^;#n+R_#?<7RGAZe9g!Z_I1XNY'7m`$tO\)),VW_,*`kCC_q=+cV#4 guY>^CVQNWME'.YW40>k^'L*L\cd18FPp kO7A:!+-sml2sp'+O;#6OpAh8n:=cFfL0ZEm3Nhf35+a&B4+tn\c7U?*Yd:VF2q!E_7a'kWSC/!0aUr- Hpq99,df"+'h$872?q\&T11'NDZT:[ee7c&DQK4dC4a.GcNds"ZScS;#rdD6#Y*PHUMX qTbrmL'8h/E.st.\?1d.>]Q6,&WU^s6+Q;3#_+CjISdLs!ud`**J5KB
  • h*/1g5V: Oj*i\16nl'!<6lVG5hZU`9OeXD.k!.fC_[UG[p5\61b,MR8snstQ0&jR]i-HJ 9EmU25*_F&0'WXQRa0='crS^n16>S8*+5SOR)NpWZ?*QB'YD'(&'t4rgacEp`#FOF>l](2N@.SFlkZr0 eCpb9Ocr3EkNPI-L&]N2G5lia<4;LB(TBAg=^B.%=F=`7o-`7f`Yua'#27_;8@_)MH"'VBH-ajQhMf2l kLe%S5TV:F;omJ"8n+m&Lt&ae$QqVg5*M&]CnX4qa>?.)-#.slH-#!*,l$1 pBY=$r?9g`4WBhP#^`k'G3cf0Q"%J:KS2hg/+5WG1f;1m=-Vb0&4@q[I@2em>d$e[;*47kH6)]>1 *Wsq7`"rqIUc6TtS4[i,=bdQU0U\$RN[pbN`O3`ff=g@_!o$4KG)P^PqF(*^k>QYd?:.4in@dZ3&2AP2nMX#56\8EZNj:Jj$VEGI>d( P+Y^G]Ve74II%OYT_guS?]r8L;r_@F[R>:<#I,_L-ktPU_DtC7HIi8Ualt+ceXha,>ug7?CULBWinn8` _O5:i*'+r**WV#V(jJW/]9s<0C]Uik(N5bq0Qqr#p2apo@6hU]aN)5=]V2b_A*pRa`m-%3_edlUjn!B- 8QaZ3!q.BQa!33.]1EKH^nkBR8&2(8+";IuFZm:r\CU+m+tNR[HdHe7js=Tm,0`l0rX#HN2rShH=EgK* ]j0)"dM+J'i`E_1'6F]aI[3`K!!g5hlM)=m-9WWg5*24(Waea?a`g%Po.,=c6`08sOkb54)7FJIlIjpi_QVoL=h+;0FFBnPW?PXT[10u.oOQGqMQC46^<.N@B_bdJNA?H!9oiaME":+ATj >bOb4@C`K%iE@p"[0_'[DY[6,b;qi`TqR\i,2)IDa_ftn:L-Coa!&oj$Bjmb`HqCIf)L%/"`c6:h$$$G D;BGF8mu`fb2%d52p#l_*Dl?t=3d/s//6YVX/i==:QlLl+WSS.NrP=OOLnO/-sh?aUg>W)I[%-#60?)R Kf:Af(?Vj"@Y$HY3#Q1B`RcNk/j&mHV#PT/g4T&hI7#N'neRt0ZuH.j5E[u8UV]Bq0j`E\JOi\*k=tuH L@46_;cJZEkT9^SBGb'-X*m,taTf,f+<0G8RSg3>K*I:I(LOE,Nb7Wl-er-i9@49]?-"umZO^JEQ.QDUIQs_RW,I$/8)GBp* fVm23C^`AL./AGu6B4uKFO@=g`K-KYGBeha6ge]-\Et8=r?XV#)15FC1(?]F,%87Vqn!MUEG)TNc)pViTt3R;M"$('m-p_3nqo`=(UY0qPXj.q!=?UF T%44*4au<=5Z71S!RWTXXDkH\M!?p.-Fc\1hF?jnD>.s.TjIeVZO^FaC<"+ToPe#C!tHea!Q)9BXCZN= dWO:Jj-1>,UpQ6+*K:a@)d[2]nV;[=K;fA$/"P:Y5kjX8-mbBfNR*8kT9tat9*^6U:AN/=q7W''k*NeG 69UiaXq5\2SCnJalhPh_KY<2?Q%sjP#/nht4O8d77WJshg[%=g7=0o9QbQhVhmg><\ok>,?9jSo(RYJNk/MY\?ST<<*V@j=<`:?13Of=V:lit4es.kiL37JoJk+uhq"Ou=/glrM!-Z$9F*hVS 23rN]J!#&Q2shF-o!30bN_BSMV)3YR(*XH[m1FaX\U^Sd^"^1fTtV;(2%2Z\c`Cdq!N!REfbMAI=f3_oIf&>0,pnP)!OtIXPJ*Zm*VV)stohDd)teNu/S@c]B0_4,#A] i181TI5[V<-n($FiZbU;W$p5Zp+.-c62n>9:JT`p[n nfGa$GgTk!icHG.s*;8_/AK@`X^<9ZO5HoioIu3VH&m_g$$>)h%@s2A:f/(0%(B?U>s9I>+,/SMoUYBS %B/ZIRi1oJ)rjb1+<7oiF^,rmLM`[Io`QLJr,[>BKLYf7>$i$8T*DiUr%J,'2ZmT>N:m8-%d0!.7Kk.b/la9ghm/ @W'[IL.9`J#tu`c99tPp]A1"+OUOsljk8+$_71867R9j<1(qKujjp%&,!M(-G-&nJ[4/=V_"e`#9IYR_ =Qdh/,`5Tinfl)bSAdj:2oDCWV'D]T#(@f4N7XIe,01TMD%sI.JkPtrDP]2Q[rT=5qYkGd)@2)`Ec,"C ,c^(QhSJeuZ9S886cO1f[>-J*A)ThV/"doqmu2E__3?q<+nofjKV49pk-nLMXcSX3!!'1>u&-L>2VNln?320Q!K"8U^d`;:B%2 6^Xj4ous9FZF(M_qPB$$%)!duG<4H_F4ac0Ns?$A`ZE"Y\`[\m#+>+Ees*lDPa8!+c+CLNOB-1.fbuKm Uq.utNLoG%#C1[-%gY+uStfr"0:=8UAT2;S]#IgfGN6sd6G-X.1RGOjh!()R:DQh4rOn6m&l7+'(oU0R Ao+P6CHHfk#$!t#rOdIm_W9aMJh_,s/Cabfb-iF_0Hr16m?cD'J\n@j;Wn(EBJqYL.IkUt@i]"3^-0!a BSAaTpf7;[?lZI*ge2hN3;@/cq'/GM0Z'<#/Gl2N'CSb^V0,d`jCYg=)b^aSh%cUp(p*)k>!NbRBOAIC @4YZ3L2.hbSupGOdXDJJc[A1hT_rRlrIHJbGhRSM`YjOrLCmL/d&s%.^Vd"d#[%iZg?KgcP-XbnoQV\' GlQg8Vkq@BK!sSb^!F=&1cd/E7+oA*sJt2#@]$E!NA#lF[e`5XPQn=[m+sEaC1nTa$VtS 3P7U(3JXa#W-[b#4(>HEj$&ZIF;'$b\;*\T:+>Q KQu\`=K565'iRE2/NLc&Kf;eVA^:S!mcMA"O!8k[(_C.#1*Bl=DOUB^B;iiHW1>;c#E;sh$$nqs;(La! 'Rr-)o/1NcUen`n?#W^oWbCJCmm2.NpCQF9W`\fR*ci['*4uF>HlZ\YZ>deKA0P(7_&7Fj"+BQgQr`c! 1b1YC$u/3erZZMN^oONU`NXVpOMFmFY[:aJm^8m-9MiKo(SMu?p[ODDcp5TKM*`HR)Wc9oa!Ip4#'cHE "Vqo8(ZA#*/pWPA+aj@Krd:qjG)%/oC`cP;eHk'/b>\?,&&/KhW:CDn]J&i2R?nUmos-Vp47O]_s8<9X 4Z1;E6\q%*K@^[GYD5RB7qu9sm*)i&mq,r5iHWG`dTPaabp-4W4=3f:eWaR*rQ?Ugmi%<3.k_)U3BpTH `64t-9#+gj\%ed#dH'?JUX=-bB*a?M4Ft]\CS;O]Zh0:QHKtl,Y-WdOOH=#0$#='607bpY3E,1RNT'3r [i:+42J%fAZ;`%B%m7loZ?:csMfrN6G+Z8oG^((k+V=#,SlQrm(Q&H+Umg"3(nhIHorj5TDB6XUU7rL. 57uV/[n4bQhSl&L+2lBCl*[A?rG5@;%$>3$G?#6=YPJ(euZ.[(e)*rOCCQL#?T\1Vbe\':A+[f_e`sWM@HAg\frTk9:GZo\$H`f%[gn q/D-o$c@.0cTfN?!BdL_b:&1sO\PdiBq"K)_gu6#'!=(1%j8hSIQa1YHC'bZQtkW6D$/iR0DPT99=gPS ED(hu'*%bh_WWm"p;dDs^*`nVD_ip',Ged]gFo_nREiLo0%'$@%_e0U 0;6:tJejtf@p`5&TraO;?;thYd$66!9>h>SK],#8cknq`mt>`lp2Ko-G=lO3hnB&-*Xlc^AV'#C%C/!\ 2LTu[3&Q,m(_8FGE-tf-jgT*QYr!JJH^=tr-AH\aG?C:9d<0Am616spbHGp=G0:`YRV+l:0RXlqcEK;^ &8E'!4Gj5A=dh#rmEHFd+&Ea3_#KSddnMUo0l`9c@bj`ELaP*So/gHsI+B]O&a_hi7l-4=7i9e(1X;i>#4;62R=Ls(.KDba8l@&@a>/Z#@9W%LTQ8$R%?t" ]P*n/Jhg&&:kqR9^J%`MFiI-5k^lTj1nL0sk%SO/=(U"6D$[=Hrk0^@b$<8+1ns;-BtTj+/'j6tIIl!l lIuq&pdC)IL=-9%!kc"hVK.;fTI7l3j2n\em+4,ke4+P>HYQmbX5n#j6bVT^1>,lD.S[J1C"54000q@M `pacU6='3u4^b?o5\uorGh/HG%E/fOKC%t[E4_55%fg\+9,ua]YmaN7C\s=ad0*q&^LsGSNe*(I$ S=S0ZBt/DK1NL'W`2d-`-6g-km$\+DE=9^Kj-]L(="\].aX*;mS*r\E#Iu/7^+(Zh0W#N=M]n8ihKWP' K2?9XEma:(VR5'$?[.jdH8_!6"9!O#dRLQu.WS;uG*Yd%83@))CIli]c@34F$,2bu`P:O'l.[u@.uh^( -,88VnfO*Mi3s?c)!nVt1aRm(Wg/!PHrY^.Z]M3m'X^2/IfuDmR7h63>U)SZf?)_oni>YE Gi]7[`^!-O25ZZq5.lM.TGHTI"'\?G,kGXtO)8)lFba Y8Je+90iPk;D2;(S@2bh#Pf`0kT'-=BLI@Wqq$D,Pg&)UJ-A6K?7d,`.7%Sp%ZZZgj6oTg=^TOUbu#n0 h"P1>Nm-IRK8-VV#mC@"h,;b$2[eLdBqPbj*;KBk_5GY:FL;DrIYoRr8TO0G_=3p^kEh1i4[7T?16WZa /8p='(aOb:b-\&Ec_&3^qQ]hB_Ff]lC_Y;-+h1/Jok6@&CHX*5=CTW@.O198dJ*qMj^;&QVJ>X/TJ9.D gKGWAC"Pt;>__cTNN8j/S5Vm_BU#^Il*73NaE3H>7Y+,'_[W?[[7k7Z49Nuti;H22N20?u^AoOUWO`pl 4@kh'R,j4qcM&N^_K]<[CHYu$UmZg@B59iplN-_83;&YJGb%2]$!`\cO=[_oG^>SAI(/-a(6c51JjS>D nW1:/U_K!%R3i@EAgT)G>:f+Y1ta&2081&"HoH7"V^0eN$u@Ur'jjPn91QiFCWHAqI[1OdGKM*bi[YrR NX9j[&6kTY/WrlU>S:47F0C`(D](VKM4D9u+^,6ZOl^)N4O4l:$rg89%6=<%dXf^-abR"%^.L/1ZaBc/ 4VM]Bjt!;;EqWS"(mO1s>WOQGa">Qk*TUh#\PcMq.AGa[j='bqee9#>:<`fEE9&1K$t.B2Y*6?0ifZ*c ,du3-Ou2JllL1i`/aua3TSCX(KR*<;mABs(?HDgP62=FA:*bJPrEV!N=tN6'1mNs-'T7nKPZs:0!k?F-S="20^)-b<#mXV C,6d/>Mbc4mXkV8-FTT2o!e4NDN/sGa%!.j!g^qK+<4=Y8lTHm@7D_15;"<@WQT-Y)#78,#<_8:KcN?] q*jdHhtd+*`pH% AK0`tK45"3Y_E!hIP__8k>`J0*;C=1/)agG!fYadKk'6EhSt9[&&uDe?J1@Ucc[XU4_4)=O?AfC7]r+2 ,sS^FV,kV0hs*uSp%)$m&o7okY7'U2b(`Fg6c'[dN%Sh/'p?HCi-Ru1F>N7Ca(KT]6?-H@"(sUZG'!YKYEF%4bO#hqKq"4_L`Krms<$C)A `(ce8ol+2XCiSQN3^6Wro_cmt@QU"j&Q3\(;Q6ELC%%lX+G(K[1'ONtEX+^!i4W@9J.=A8p]Em[6ZnTu q3qPBCD&l>A@t>E+P!rib'@WG,f?-Tin:n'ettdL9A.3)2;;oag(n[;Z9s!jWPR=WW(6E/Pdb\aI&O,r eYliXD$hX6d3K`.([?rDi?#VY*be$EKNXcQ$mafajk3Qr`r4M-DPQAST;m!01MKp*l[\2$#FK?&l>o\0 *[l.'[rZsc'K'=S66p]b2s#h1JW6@Wmrt3`6cG)-;DP>!4>d%N!t/uj>mnS9Mn1h=lZW7:P(0V5onK*# Urk?t>'5f(V+Q,_B8Y5ZQCSt<6t8\5hon)Ipp4aD(Bh2P9LV,fri>Dguc^prE[$@KP+0$J?E=NL#i[Q=hCWb5)I4s$3!WW=QP-%XG+AJmj[kc4:Ji\L+@&2I UDrSq5%@S[R._Oa(UK"X4Q.XscTPj]rR39er^1All4r>2[c2M?rA5BdosUKG1liI+Y;V4UUP6++T8LKh --@?=.0^#rZl)7*p0e&3)RJZFg2L.M+bl6-qFn?@U][m(8tr)>D#,CJ@-K&L!)Aq@^G^R8M!FM#ol;;@Zd6cmhn2jY[@Gp a:6.!,G#g.h81=(.>>>4h"i[i]A:5h ZJW86o965V5jP[47GJ4-R9N4W"`m/#`N"0j1HeB#J)Dk#`U+fYCqPf[5_O?U8Jk;=5FsAG#lk`DM"..M o'hlF6lUA6?dFDp3,&(*0BmT:*JP^DSOA3S]q_Q]XAB(.bAi0URSW-hIY4$=FW;UB8rh^FH4k92R9C'7 75+p4_Ock>Mr.!#Ig9N@0>Z/!K56`7C^Wc9IF;'CQ-CW0Rl@ecG-$FNCR(>Fpb52-D).ee.Js7\io["D$jIQBH j[[rpm>D^%KV/$^s5f1$g"U#p")Wce'#3O`Q`3h1TN'&u&3<0'9V^2FGs5#Kl*emb/rhM1gk%QO]fKmqN6g $G:BcHZ!-rUM4;[tk"fVh'o4Z!*ok@gQ =qe'So1j&3CpRZIWnFfL2XPug@b-,n74rEZ!T>!7k=Eo:mlMl,-dEq],phHP91M(hjUE:QdjrCqSA<]UBEkJG7)ma@gF$.Zq .SAm2^X#q9,IoanGddBbU="4&md]FU&4=:+YEo_H(N5tXhN_@[B,1]Rl>p"NSNfDgitn'qC)&%lk5A9] G:XF'68al'96jftKZ`GZ8t6O!+u*6dH[DMV%"l]9ibRFQk>Q,IH(t.eB][UC[e=77Di24p1b,+[RYHc& M`:nts6tAuHk)V$EC".dgp(!:kH13t*,lUjn/ZRSdb"@%LcT7_(:@EJnJH2\n,.9Fk71 mk!M"IO9tl[EJmqj'Pra_A8spP'0&o4Ki)42'pL&Hn4s8qkC[R&.+e,Q"RSR8F_(E6sq7_+a7.O!p$Y5 Z.TiHQC*^"pPG`+?]"7h9?gMYqq=%1fq\*=CB-CI`uGc1riZ-9&rPL$3'Q;]qK`%.=::^S/lO&CoZik> *aTSHZGWE6?f5M%$?#CmVBElg5@MC*@=uMomVmF9]]=f7a4O(P-L'(X5^PCXVDoGD4HE=)GEh/#NA+jA ;\$Z=9$2:#;mM9N`7bLk*C6D#nr'_Q^-0:Rf.#0a.8r"=MilA-jjdPSOJhjS0d?P=]glF^hL^b(/CJjG aS;:3YrF\aV=$tUmE%Z3e.hK36MJ:5XW>`7k<=.7%La8.1B8isBq;,9l4 "W!Qo,/Cbrgf;Je"Q!lfZ!Mk<+S!>.('e4\Nt ^_i?+h$d-m;=\)2V[3.-h5-!Ag /2RSq0,LpRImpJ&nP?"'F.f"^g9nBmnV_[mJ_mZh=0ua#dd[Zt.c0)S1Ucr`g,:D:K^5D&It4o\`lco^ )\]Um19C"RU#-eDDAAK@ScqUZZ;&rS:&du+c/'IJuZ7LXU YY:tO\K^uY.ucE"8BVT[)lMWf%WWks`@4/uZ_8.I>Q5g&28(h:Lm<1,(p9 oI?8V,Mq=8s7[\+?Fp-X-`_D"1dBp$k!B*&4Fb4(CFT"P5@7GV::Eg387hts5>0)^dN81",Tsp&\+"&f !is)uM!N36'C0,B\LbUA(I'uqK*MfnkfLQIRoT/F[*]__#DPFV55\$J!ik/#Ktq.p>Z7\."J@5o.<):. n&]h>NfbTi[d^QF4:\*C'@[deqg5qBC)UqZa+9ISLC?"J=.2<8&)E5rCBAp>6jr\R-G0$fo3OI+Pj*"S C*u-Jgrqr?\tZH[rhq:+W@]L[@4bXoJB;m,i7:W(Aumi5F8O?`8*e"G*CE7T:+cR4?0i*L!j-'t$7s7% &[S,kaga(&9dYe;]Jn(%`UWh4O,A1>4M^_"naTDMDsHAl5a`BJgPD48(;5WDWZ'!&=p>-A's,c=NsuP] Vm%n/EOH96YqY4K<%K(;_7!c+rbcu:niO6BQN2Wm=NX"1g=ZZC.<3ts3?Q?k:T6mL8V*ZXB$VmW;pl`eno5\^2jY6(Oj66sTB4AI23E8ZkZFf[XH#6dk%cMb@+V C.dCnOPk7sEle)irVf%'7&6l2E)p\PLYU:?cY=hdB3_sP#8OXDWd&)<]75hR>)i>HkQWRK%BEC$Dm/C& M(#8$C'#6C/GVVu]GWPE*gINQ1C9D,r]8pA+MH]06*pLL[e18=godkr]mZjLmU.HKOe_,"k7L2-OjW:3 2e\7EN06DC(PsfmU-X.T><2p2[;I*Cq>2]9qhl)=^4 $;Bgp.$Z)?S-[qhD1aDT3Ed9`%>a:d:1@"k[:>0JN/qA?7Bt'Z(j=O6,ZT;0G4gV<;,DnjZ0+8Rg+R_[i/X.cXl%"E/a9sWDussrJp-2(%:D:Uu[W6X6SJ&s9l.-*h4Y-i7?V,S&5?n:_P2YEQnUf<* bW%r"f>C)GaN1.=J`ErJ@m%+8dj1t$j*W&XdTNBdM$?9Jc+;hciT']%G$HBMWa>`N_,D-RA+E6A/'!A% EjRu&h_!.TGuT'X"X!(0rcdLXK5ju&RW"J7]?)ThZN\@P9W3k^j#j6'-c3tPd4+=;'*rN[%?W<]dV .bGo$iE"-G!bnGTaJDimi+n4tAjEtR"Y!T)d'=GV*h4U2fVk'!K^CJq!HQU1"`Cl;E*,nZO&XDpjF9ee VL2+MSG+T7nec!2>P^Uho*+H:au&0g.aGDL^]Y?=)GD$3n@&KOAJ6oh_;s%gDDRHA4YfH>0cH'nZO?V6 M,q_%[\BTHJQd)9d)BH)qllPB+ZU"i@)2o1Mq1*@-GI4>=oRO%g@'E%c_X]R+hHs=3mg9&c](*B;nB'/Ve^?-1?)86c*rR0;>VC<=+G*#\!e[Z2@O;Il.[.c#aH3DH[Z@!KURTZMT4B&7*M=2Z=tU@ 'b%oCT;8M`gCH_@s81Pt0,k/b_=I::PeS\PImpiI*5[X.7Ze!\2o:iOO)/Ye*WJJd@;^A\Z@^*oWH(mD ]S"?PUFp&XY8k2aGYu8,V9/K!Y;V*Z+;H*(1?j>;],K96kK;)3rk/nt\Cg6/HH76WBas/m&/Dk!b!Ud5,O[`SOTaXLec'f)0G`qC#3#UJt6Z]-5*V6?D>i.J^p,_#6;bRoW MU^Olac46u]T4M8A0%5R",dn$jdO3C%\91"MuDeS8ao(6eRd@fdP//8&hIQRY&-9n+8 NG7W&qXr!cloh2oF_)CEg-QpA]D.[JM$;LNn$S.:)T!A!$\;Ut=sio2gE,4!26ENd7M0"LE9M;@nrItT f&hd!&&pr/B4k[nhQ!kH2e$*[a$X7tk@7)h3OE/N 3qtgm+U(/#]QRDT`pY65r+`fe3)LO-Gh\%`i-'u5@p'Z>n%O50busdnfbABk>ukcnAD6&S_"3<58HOt> ^!`MZmLGO5GV[?8^AchI?4`Mkr(&Zo92_,E@VYLAns?hf)namQJk%ZShK,\reSF5m7H)S4P;4+V4CVI> (O>P@o3UOXX1mnh]\dY:)s_]q4(dr'N*B!gA`>!\".aRFPX=!8<1JKa4,>bg;NU)0)%2eWX5ErbYn:X^ `6QT=&Hr[++un\@1Qq9cR]\H>!+8p?a^5Ta&cJ:/lUT6]@X'RFQ7]3oiL!,_.`^!h28Ec78qN9[?Kb%> '0ps`"E;]R9us*@iH9*l(V9ldlEFGa"3C46DJ.u5_]8JmK5Aa$-'hI6AQ/p/k*hfbf*sDh8_e4q<:Z0j 9tl<#PgkhS@^AC2r6SaK6#Dj!;$T8ZNtl$Z-l.'%mNY9OP5:2'jpZ3RX+.=e1oimR"?aH7,1$KR@k8t3 Z(*6_-;KsB8UA4+c'NAffib"n1R7-@q4,N#H"#@/U;K/;7FZH[d53dn_6J+E^l`qG%LY2s7V3F#"@\$r ,^@H4J?GFH]q_;:.Xc^QcH)XuGO9WAL-aI^aQr6D3 9E<,*=ua>%'J+(f^Y^[)=pk?IlkB^b'Q`j]D]s3%7[iaHcD C9`K=WeIf11q0fZT@>?MIZ:EO@Kb=bK\NEhs/CWPnq0kZ=+oGTRX3+5Au5=F6XAU`Hh`A($c"]&`0UUbS<1t_/=!r_q]DeE@8S##YuXOXR$W@"0_f5i(-2;_duf9Ycoi1$Th-^GfB4*[F_ROV+^'je DAF]AA'u\iUjKX<)Q$%Z;L2_3'/V`s^AbU`7HE%b+'T#"MFeBE?WA%IaM)ZXX?V1EV8?H%]%`JcYsK$& FGk[B*1ii>\T4miVA"%*YPC%\.Tl0Xbk]V?Kr/EHF0"N54'jKs3PhI2^H4VD+Qh!n#.Ttr87%9E,p[jV ]au-/,tB,#bFU?qWMY*)`BR,KWof[Z5WKti2OUfkI]8+DEE!I-/dXt=m8&j*-4A_\j0bG[`o-m%PWY.iUh(;uPL/MnoqLf;2Z0H>F0Zrci1Ke_FMprF$(]FJJFpj,V5kfj:to 'V,*85#fd^4J'P=^2D0QYS"78E,NqOBFs=W^9,-TXboH=k%_GY>^VM0hB$oLO!>";bYC3fkF4nF:;iZ+ 9-*@ZN!X)I0]4ai=':?drNG.0E.lM/rkhobT\B\a"FK$N)ge-"Rj2)P"iB]EBFi\!]PB$76,7W,KHT?u k"RsSitTW'KUM-krtGVa-7>Q*@U;^h_@&G+D"j+kJV8a4pQdRJ;I"f*DBBBsMM.fFbZ5#6Zl?$>_Na+9 ?#hOj[4k;Kd&R)Ug#[G$]\WZV'm`nIl>Vqj2&aHAEUuLo^C1Cf$C#I2M,gn$'jZrDQN&h9eLMT]S;pVa c8_;R@j)k2)UbFc7.##Dp-d%#!PkO$,;La9k4NDAcAsX@n&T$!\"RW-&"KQcZh_?8r=rgRC,35=MWsg!Lfm/ BuX[_nr`Ine#0G7_)=l Z\;$JGn(`If')d!a/lW7a*WfAE8-Wi(G<4!F"TPhCL7WU^.$/CfEomA@3$OZ"Us#JT?Dj/cA?oTaCJJ' ^U1^4m?u5&%2<^p7[,EmC$I,>pXcNZic^$];qp5E<\=Rh]Cs`m4XhiLGnWeL`t/3fGe+h[XireN,BN"M :G+6T2!gO;fZcJ("B8EZi(>gn#baINBdskk-lf>2I3ah=s&/PnJB24kpQ,kB"mfh52Cp9GYaJig+p.p; PXIlK.Y\i^<#"d/P*pQ>6/7Wrhkb#!%F=Qqj+eeIMGjJ<33jmJ]s!+F8;eOsU,)Ns0k$:C^2A-0Xshuu FS-XCn&9a@cU9L!67poK,/q+`TQ2-X/qL:##I]f_L\qN=6QNe,k->M*e(32JE2j-N.4f**.dVUP)fNQ"Vl@KCZWr&HE2Ucr(.(e:sE72Z97.\"$s0khn;]MFq1he+t4;IFCaHM!mFjp%K:5RQR"m$?WXus *+]4HdXMQpF/AE9ZLfLmUL..M%28t_ieq=Pr.hDXFF92u6PsP4,ZsYc4CIK5MkJ-GWk4'*RR@51&7kjm XB^A0IaJ0*@An(5Q/Am5\KLSKksi;P=['pj2i8uUXm@GoXNl.0)hN[$rF?ZNS>sFNHM#W\jCsi3l2e+d 9ErC(m<#RH-=i#F!,-6l2IYV`;FH28=&F!,mS7UqaVhoQ3GMf`7;PC_F*b"/#sI[h;dn%d7kFSVV-FTU QcdEX%H^pXqC11B\u\@o?[822PH0l>$Xe$_@%0o%4f/L://;Q&5tMt2b`L4<(?VepR^;*BjcDV>[iUe"86N>s;@XGV-m1]'gRNmEifn^1^4sVCh+gf5 7+!;gEj[TGmtIX+*c@LD\D#o+$AHB@<0**JTPgcVY-mU5_IL[_lGa>q:<0aP_=$.NJ`^ ?57K(7a4gQW];"hflg%kQMpf/S-sXtLU%E=SbUt8fjr8.j1[prdS#bB=#W.Rq#aKSgJ1"`6NDetXdGJ8 ^osQdH_2M.I,)I^)8BO^N,Wi6ZI7l5.3!h]h;)\7XB7s?K(aJam1aTC-ZB"UR;?pnMOTA%'e+lT,?Z\QX$/fu1A!Odb\3@bSSlG5@2rArfgN`tK$=;+o*'0'#Yo2lW*lNn:KLM5jKj5uiRJ e"Pa`1^,]4l//*YJBP:?g*8:*0JG170JG170JG170JG170JG170JG170JG170JG170JG170JG170JG17 0JG170JG170JG170JG170JEqi0JG170JG170JG170JG170JG170JG170JG170JG170JG170JG170JG17 0JG170JG170JG170JG170JG0i0JG170JG170JG170JG170JG170JG170JG170JG170JG170JG170JG17 0JG170JG170JG170JG170JG17%59Ii0JG170JG170JG170JG170JG170JG170JG170JG170JG170JG17 0JG170JG170JG170JG170JG170F]]i0JG170JG170JG170JG170JG170JG170JG170JG170JG170JG17 0JG170JG170JG170JG170JG170JEqi0JG170JG170JG170JG170JG170JG170JG170JG170JG170JG17 0JG170JG170JG170JG170JG170JG0i0JG170JG170JG170JG170JG170JG170JG170JG170JG170JG17 0JG170JG170JG170JG170JG170JG17%59Ii0JG170JG170JG170JG170JG170JG170JG170JG170JG17 0JG170JG170JG170JG170JG170JG170F_N.ARTV$Df&p'CCL~> endstream endobj 105 0 obj << /FHShade6 144 0 R /FHShade7 139 0 R /FHShade8 134 0 R /FHShade9 128 0 R /FHShade10 122 0 R /FHShade11 117 0 R /FHShade12 112 0 R /FHShade13 106 0 R >> endobj 106 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 655 0 0 0 13107 17694720 1 0 5 0 0 0 3932 0 0 0 6553 0 0 0 13107 13528 22546 44191 -65536 -65536 -65536 17255632 10 ] /Coords [ 1367 15259 1367 14789 ] /Function 107 0 R /ColorSpace /DeviceCMYK >> endobj 107 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.20642 0.34402 0.6743 ] /Functions [ 111 0 R 110 0 R 109 0 R 108 0 R ] >> endobj 108 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 109 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.2 ] >> endobj 110 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.06 ] /C1 [ 0 0 0 0.09999 ] >> endobj 111 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.00999 ] /C1 [ 0 0 0 0.06 ] >> endobj 112 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 13107 0 0 0 0 17694720 0 0 4 0 0 0 5243 0 0 0 0 19841 56517 -65536 -65536 -65536 17255632 ] /Coords [ 1748 15259 1748 14978 ] /Function 113 0 R /ColorSpace /DeviceCMYK >> endobj 113 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.30275 0.86238 ] /Functions [ 116 0 R 115 0 R 114 0 R ] >> endobj 114 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0 ] >> endobj 115 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.08 ] /C1 [ 0 0 0 0 ] >> endobj 116 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.08 ] >> endobj 117 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 13107 0 0 0 1310 17694720 0 0 4 0 0 0 13107 0 0 0 6553 51106 58020 -65536 -65536 -65536 17255632 ] /Coords [ 1208 14784 1208 14503 ] /Function 118 0 R /ColorSpace /DeviceCMYK >> endobj 118 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.77982 0.88531 ] /Functions [ 121 0 R 120 0 R 119 0 R ] >> endobj 119 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.01999 ] >> endobj 120 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.09999 ] >> endobj 121 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 122 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 0 0 0 0 13107 17694720 0 0 5 0 0 0 655 0 0 0 6553 0 0 0 13107 15933 44492 59523 -65536 -65536 -65536 17255632 10 ] /Coords [ 1608 14974 1608 14503 ] /Function 123 0 R /ColorSpace /DeviceCMYK >> endobj 123 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.24312 0.67889 0.90825 ] /Functions [ 127 0 R 126 0 R 125 0 R 124 0 R ] >> endobj 124 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 125 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.2 ] >> endobj 126 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.00999 ] /C1 [ 0 0 0 0.09999 ] >> endobj 127 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0.00999 ] >> endobj 128 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 3276 0 0 0 65536 17694720 1 0 5 0 0 0 19660 0 0 0 32767 0 0 0 65536 13528 22546 44191 -65536 -65536 -65536 0 0 ] /Coords [ 1367 15259 1367 14789 ] /Function 129 0 R /ColorSpace /DeviceCMYK >> endobj 129 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.20642 0.34402 0.6743 ] /Functions [ 133 0 R 132 0 R 131 0 R 130 0 R ] >> endobj 130 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 131 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 1 ] >> endobj 132 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.29999 ] /C1 [ 0 0 0 0.49998 ] >> endobj 133 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.29999 ] >> endobj 134 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 65536 0 0 0 0 17694720 0 0 4 0 0 0 26214 0 0 0 0 19841 56517 -65536 -65536 -65536 0 ] /Coords [ 1748 15259 1748 14978 ] /Function 135 0 R /ColorSpace /DeviceCMYK >> endobj 135 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.30275 0.86238 ] /Functions [ 138 0 R 137 0 R 136 0 R ] >> endobj 136 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0 ] >> endobj 137 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.39999 ] /C1 [ 0 0 0 0 ] >> endobj 138 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 0.39999 ] >> endobj 139 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 65536 0 0 0 6553 17694720 0 0 4 0 0 0 65536 0 0 0 32767 51106 58020 -65536 -65536 -65536 0 ] /Coords [ 1208 14784 1208 14503 ] /Function 140 0 R /ColorSpace /DeviceCMYK >> endobj 140 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.77982 0.88531 ] /Functions [ 143 0 R 142 0 R 141 0 R ] >> endobj 141 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 0.09999 ] >> endobj 142 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 0.49998 ] >> endobj 143 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 144 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 0 0 0 0 65536 17694720 0 0 5 0 0 0 3276 0 0 0 32767 0 0 0 65536 15933 44492 59523 -65536 -65536 -65536 0 0 ] /Coords [ 1608 14974 1608 14503 ] /Function 145 0 R /ColorSpace /DeviceCMYK >> endobj 145 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.24312 0.67889 0.90825 ] /Functions [ 149 0 R 148 0 R 147 0 R 146 0 R ] >> endobj 146 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 147 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 1 ] >> endobj 148 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.49998 ] >> endobj 149 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0.04999 ] >> endobj 150 0 obj [ ] endobj 151 0 obj << /Type /Pages /Kids [ 29 0 R 33 0 R 36 0 R 40 0 R 48 0 R ] /Count 5 /Parent 56 0 R >> endobj 152 0 obj << /Type /Page /Contents 153 0 R /MediaBox [ 0 0 595 841 ] /Annots 197 0 R /Resources 154 0 R /Parent 57 0 R >> endobj 153 0 obj << /Length 1570 /Filter [ /FlateDecode ] >> stream xYMoF S!f?S؍&Mj!9=2mDG͒")YA^ /ٙom~$8vj<4Xu.*v*cdxʱHc1ӸȣIc+}Ž0I WFn$KJY`yT>nLZTRspoM5L/a㈅x; g6#/-R9r%6-bKLk))Td ;?S|HveʨZ+"LG؇Gl9=9y9ϮrsX8,΢:HgsQ"ʝHr\ڔ^7" PJggvQBE [Í Keݳ߳e~2Fa򊖺(r Kf]V/:ٴ o55 e7˟ ¬;9ò⭳I8,> endobj 155 0 obj << /Im36 156 0 R >> endobj 156 0 obj << /Length 11892 /Type /XObject /Subtype /Image /Name /Im36 /Width 909 /Height 877 /BitsPerComponent 1 /ImageMask true /Filter [ /FlateDecode ] >> stream x=q#J0.mxHd 4R(HC{$~ ᗤ{\{~9g#?4(oN'C?ܦ?K4'qAqD #^:GH*gA qI#8ObYoSG\bo$.ӳxV,[t"b6=(`L#⥁^U#׉"ӛht#tf?\}=\l/U6D5ȄO&7$ļ%Бż#?Hdp{ !h) DFl58cm[;Nq,S8"q/(UDLg|ltt!1#y7Ԉ`1xfZ_ׇbQr}VD)\aYhOt @c+rrǗ9X<G~ ."D+K 򑧧DQ_w7o+WsBgGQn`A%~tvyi!qDO)lD :etލRk&9LUiVO\ :KNOO$ oE7G\ <&W; )F|+\t̔dIo3REgD ? rV5W֣Syv|@QnzixHv)_`IDv%*Eatv4;zIyI֮c#>$B>Oe=j?l#S*J9&V@t{">zThL.+ӈDDdXf9vb8⍉+& u #FZygx3NB9i" ʅE} scfUb 4nO:YAIN >)zg8c-o:}S! <[qI,<]-AoD%6Dy22OmݶQ];@T1{S1t[ϵ'4-̢V-#?W;YG]?1[ i| eHT#l6̈́#C-fnɝUBSWO2F"|P3LB{Dqߗ"ݫ9e+:-:ѵ{NCDeVyk祧ѰM~?A$΂#΄h9_ߜwQC^!pĭ_K" TDOKLV\yfܝQuA6g8D5luxu#cnihLN.Rz/:v?1U>F<۽_60ld/]Fl`XO\t'RtHjׇj.U1%eTͭGL*vEDvc9tW33ܼ"yF$rA)dDOotV*q}D,N5Yt:UE䉼/ĭ$*lwir"{6$ҏK1FI[tV9}D^! qm0""l 4yOݬ;J\Du%w6bA$] [cD1J,UPw*DYLj#%oGUbr;,3֒C.c㯟UX Ah rZ?cDYvy Ҷd A/c hYQxhx5{vd9C=.TKv?îͷJ0G>}/CH_:Prs3+$_ۈw;jNvU1GQ]bmHr}X~i[Ddk*ƼBiOxC6&JhqU^'T=% TLyݼ=<*㌡"Oyy9?<'gDĵ#G=#ꮛV?#&T980DnX"gĹ&#Ūḕ )$dhHnM筡X5$'% EQĭ>\y[׬iCɝ*ܫaT؀SS|eX#_?mrkI}d򍽈Llޑh[z'dwR[t7<ΣP mRj+$/7p&7 SX3؆_}=R|JmKdC\ L|K Fҗ1Q#tET!M)2ĭüSʉTXU Q:$ҽ^uD?2"&247VxP|Uz>Xnx9|5H~L&eO%Qb^Y5Lq+1Mɲc=!&{7ń(ht/?2ҝ?Y"C~EI]25Mg"W8ʢH#^3'͚k!P!BDYLkhC5PY[*D{8$6fq 6zB7a58bCKCC//Tr4MQׅG'"b+Zf:Q h|ĭE1Ĉ-Uȷ) \P"ND"J/'Ζ6k6]̆VJQ%ZD_yq}D\Tioҷ>*sqRO[N^!"4rsqJP㑾M4=D+?ǴIAd씉mZhj'.=D3D/1uXYVjlX^$ }#1FPv74ɡ8ׇLIKXN8WGgo"Q}#FuMω{Շ.M4C$k6)L锼f u7 , 2x>w[70㇖*HY$n}5}8;~hndDG$EDSd-KJDuz̏my?q.HDh$oMd!GGį蔼cK=K8Qa~){ֈ~Elk)qq_DGGփ%ifDҊ2GEDMhÖ&NG2+o;!<'>%"q'.DY%SHƈ ĽI\Db" }^E4 bHE"sD$z}SkzNcyq#WMJT-~(b"$k2T$!jp 1``jlD}D y'1LC&wG#>C&~87BR;VsS"GCbDg"K,"^ ĹM]Dȯ%9SD\:!(LLGO :# Df Kni?VC(Yv+>~5Bl`_[W#UΒĆ-R4~#ZeB$з_1{KHvGDnNG,qS6F4q*r0MQ\8W* p| MgSN䏈k'+À,,D=3$fஎUDv·($xӻLDLi(N$o )S˖ˈ&q=V ~Al !Ne%bQљ@!|#m"ʈ^S>:CNuZ qCY$vʝzDuCG$k=QH5 /"wPk4N׿$NHL8guOA~IugurjX[P$jפw/#=iX>ʓHS"iUkM/ &1?mi}tn[Tsv*?rHMȼ&"Mu[*X\:':ݩH< -+xK䥩î>g=i-'Ο:iB2_4|!SDS$"l <@u"-)Oi#35R2b:"&49' |BMgҁ ")5.9 ?rD445RSL$p1bJ=Z[ĽD̒,xV%f\ Z<gRB`=L ߴ2vedƆkm*(F\Ǎҩ6V;1qDvڕ@ܐCLR\4q">-Yiu?E&le&`q$#f̥>8E" W\D>D`oJ&=&D`$DyXnλ'7*DuIL%"tK&@`5WN> #b)c8 EC=4%n޽ܭ='N4(YkvȖ mEF%,y/s Iy~\*1S䗏 ԝe>'Gwt0E@GijD]lk:Uy5@qK,}9-)=Rcv8⃜fgzekC 5 \&͕+lh,L!/7(Éqd勓*#G**ϔ\0ųJfjB1;rl"W.\K;fB aDXH";@'J 8@;g΁| A2!㰓N'H GIe[([#Q;8~`JH* ș)~&td,DNŊNfH$GcW k 1%b ~ я/L,1QebmE0Le*g2=Uw%~by99 X/eDyFb"ΤWM0j,O8$yńՐG\}$Kq:}D:O> "ĖQebGSZsVI#9 ]-.($?Q8]%a"$;6udԯ+ 9OL$ՈM"O frB %#b'dK75FA}lA,}hH+d2'u-;|-] D% kqJ(Q V/hG]+M"rZ9y5J]c4m+4oCR~ML@H&8U6O(r$sEb _aQ!uD2BD~42#.~7HdFK>v,N }?e(%w) &ؾEHa\{F5 $p@Ggyg,Zxݐ %BTLK&/b܍N'E6R:^b7n_Y r4 PXQE?I Y Ґ<ˈ6'$ser ~x73, !M/sKDH[DW҃ū~#n#%MSжJٽL{ʸI)_M`ju' %[d 5q9k#cW,:um(Yb2E -#zP"+h˃zyU}2'rK;Ȗt5csYFRjи춸'6_@!ZJ,< hArmQ' ĴL$"Z̴cItCTYx3@Dkn^rSH(Q͞"]^GS$˻B^R:>!z%rE’Sun37tHئ? !'*m %n#S@晴-d]DJ,G0a%MK<R~d@ẅLsjĵvjr ^Dg{U+%K^f`mlu^q:#E'ry>{vq%kl.l+~,c.D:=\]إAsb @lSWޠ۲qJrmbl@I\ڑI׆4r5٧jGkJ o$wn=U#Y3C;K."%.-b |E"i7`inGu`ÛبUXe^ LŪr,`DV)Ud_ǫuÒkP1iUnbL5ӵ^x55G5_c[kJ:~EmikxU K6lhi/ͪ8LbD+Mm#f ibɺ7+ 02T,<5{LB =oĞSj} հ>~,` z'ҙl#'ƈIQ׈ˎ(zW:MG yif (2`i8'J)6GϨ_vfDKXI䃇[!,H#nugyĩc [$UL MT:  ,.טּ(d!R:bRɱLx hDU&R&.J>̨5_Dm~ņ;<"^ sG8':B6W$#u"I[cD{?/b9h^4uI0 .M}Ds_-q.)<kz\W1JdQhw~Ց1= $fD\>dd{!fWMՏc{󵢴@]WQEq4m.O,&_{)#-Vd&~ kjO*W DUGOC#3%/aN>ժUTT6mPOY,Q8 u\]elUeBV/Dp*1^p'dBO I8ah9GD"0UxEA}~~zp37~ )'ھ.v9#6k GheZ!jBvo3#l!I/m"ϋ[\qe͡fz$=# «0lH+K$bu"}6Bj3!:_"RPaѐr@yy\#fDD0V<'K:Ɉ|H$H4c:&r :?Nm)]Y?wèub/U HaH4Ղ̞椲\K>&=![F$1-8y @xp]#Dqv{Dd 1$7=v+DV B4ˋ^UDkqQbWo*Ԉ%<3Ho?dSplK ݦ h!e+ qV1it;N|ܙ3 [Nu"/ͽ]cc_wJJ@>&)OȽ_٥5q Gyxϡ9[][җo$6\ˇ ׻I?YsU6gYoth.#@\2nC\=e!Umm^bD࢛D1p!/ܵ_ Ms"!*@#6b\(fWe5{N:Qj\sӗ-JgsU rǷ(v=Md.Ѹ"P9W:>7x!\cVq eArHmmyר^12-_Ž Aӯzڬ/ cF\Q%5W:z Cz߮4STfd~+;avaU?Q|{:2RzՎ{4cpY \w+ηA&.`jipșt# 684APaWGlDǯ]kb@nxHMf:|"163x#Ĥf͠` zP`T+ ̸IT1T0cK޻(ӭn^BT'Pkn?1٤9?%G\;׊oB,d|@Tu"Em"TɻD<:86qXnm,ꜴcׇD6FV (_21єthlQ mC5+XV.y&g["no )E|ލ @dU/yN{H R_ F[k!ɿ>'MD1ml. a}U"DH!r5{ +uϰ~]c 1 m+R u#kXE^GD&!ܱ?VYЮ%x2ݪ􄸃b0ߘ脳ijDxjDo`yn&nL᦬F\'-^$B#?LQySbrd1}1?&. 䛈y uD613xD4vfΨ>#L{F_[ xܶXэ{D3 %IRFmoV¼(MBލ-|I$?ITwpj7Cg9~K4se%5aǏu%cGzύ endstream endobj 157 0 obj << /F0 102 0 R /F1 159 0 R /F2 158 0 R >> endobj 158 0 obj << /Type /Font /Subtype /Type1 /Name /F2 /BaseFont /Times-Bold /Encoding /WinAnsiEncoding >> endobj 159 0 obj << /Type /Font /Subtype /TrueType /Name /F1 /BaseFont /Arial,Bold /Encoding /WinAnsiEncoding /FirstChar 30 /LastChar 255 /FontDescriptor 160 0 R /Widths [ 750 750 278 333 474 556 556 889 722 238 333 333 389 584 278 333 278 278 556 556 556 556 556 556 556 556 556 556 333 333 584 584 584 611 975 722 722 722 722 667 611 778 722 278 556 722 611 833 722 778 667 778 722 667 611 722 667 944 667 667 611 333 278 333 584 556 333 556 611 556 611 556 333 611 611 278 278 556 278 889 611 611 611 611 389 556 333 611 556 778 556 556 500 389 280 389 584 750 556 750 278 556 500 1000 556 556 333 1000 667 333 1000 750 611 750 750 278 278 500 500 350 556 1000 333 1000 556 333 944 750 500 667 278 333 556 556 556 556 280 556 333 737 370 556 584 333 737 552 400 549 333 333 333 576 556 278 333 333 365 556 834 834 834 611 722 722 722 722 722 722 1000 722 667 667 667 667 278 278 278 278 722 722 778 778 778 778 778 584 778 722 722 722 722 667 667 611 556 556 556 556 556 556 889 556 556 556 556 556 278 278 278 278 611 611 611 611 611 611 611 549 611 611 611 611 611 556 611 556 ] >> endobj 160 0 obj << /FontFile2 161 0 R /Type /FontDescriptor /Ascent 811 /CapHeight 689 /Descent 189 /Flags 34 /FontBBox [ -101 -251 1000 1000 ] /FontName /Arial_Bold /ItalicAngle 0 /StemV 0 >> endobj 161 0 obj << /Length 284560 /Length1 284560 >> stream pDSIGR?GDEFQQ7TGSUBTJSTFm*iWpLTSH&XOS/2 3VPCLTAG?6VDMXVp]cmapܣ1cvt ؔ88fpgmGgasp Pglyf~(ިhdmx׏yheadǜfY|6hhea$hmtxRp:kernAON*PZlocaDDmaxp  namev`/WpostƬ%<1prepol].5_<<KEb >NCQE <c/AMl33f zMono Q3>@ _z Xh|&p    b fD \^9>,B n x b E aJ 1 3 Z.i   7  5 ? XG     &  W b  f {   \' ' ' ( (+ (I (Q(e(u(((((() ))5)C)] )q )))) ))$ )$)** **- *)-*3 *I *W*q* * * * *Typeface The Monotype Corporation plc. Data The Monotype Corporation plc/Type Solutions Inc. 1990-1992. All Rights ReservedArialBoldMonotype:Arial Bold:Version 2.76 (Microsoft)Arial BoldVersion 2.76Arial-BoldMTArial Trademark of The Monotype Corporation plc registered in the US Pat & TM Off. and elsewhere.Monotype TypographyMonotype Type Drawing Office - Robin Nicholas, Patricia Saunders 1982Contemporary sans serif design, Arial contains more humanist characteristics than many of its predecessors and as such is more in tune with the mood of the last decades of the twentieth century. The overall treatment of curves is softer and fuller than in most industrial style sans serif faces. Terminal strokes are cut on the diagonal which helps to give the face a less mechanical appearance. Arial is an extremely versatile family of typefaces which can be used with equal success for text setting in reports, presentations, magazines etc, and for display use in newspapers, advertising and promotions.http://www.monotype.com/html/mtname/ms_arial.htmlhttp://www.monotype.com/html/mtname/ms_welcome.htmlNOTIFICATION OF LICENSE AGREEMENT This typeface is the property of Monotype Typography and its use by you is covered under the terms of a license agreement. You have obtained this typeface software either directly from Monotype or together with software distributed by one of Monotypes licensees. This software is a valuable asset of Monotype. Unless you have entered into a specific license agreement granting you additional rights, your use of this software is limited to your workstation for your own publishing use. You may not copy or distribute this software. If you have any question concerning your rights you should review the license agreement you received with the software or contact Monotype for a copy of the license agreement. Monotype can be contacted at: USA - (847) 718-0400 UK - 01144 01737 765959 http://www.monotype.comhttp://www.monotype.com/html/type/license.htmlTypeface The Monotype Corporation plc. Data The Monotype Corporation plc/Type Solutions Inc. 1990-1992. All Rights ReservedArialBoldMonotype:Arial Bold:Version 2.76 (Microsoft)Arial BoldVersion 2.76Arial-BoldMTArial Trademark of The Monotype Corporation plc registered in the US Pat & TM Off. and elsewhere.Monotype TypographyMonotype Type Drawing Office - Robin Nicholas, Patricia Saunders 1982Contemporary sans serif design, Arial contains more humanist characteristics than many of its predecessors and as such is more in tune with the mood of the last decades of the twentieth century. The overall treatment of curves is softer and fuller than in most industrial style sans serif faces. Terminal strokes are cut on the diagonal which helps to give the face a less mechanical appearance. Arial is an extremely versatile family of typefaces which can be used with equal success for text setting in reports, presentations, magazines etc, and for display use in newspapers, advertising and promotions.http://www.monotype.com/html/mtname/ms_arial.htmlhttp://www.monotype.com/html/mtname/ms_welcome.htmlNOTIFICATION OF LICENSE AGREEMENT This typeface is the property of Monotype Typography and its use by you is covered under the terms of a license agreement. You have obtained this typeface software either directly from Monotype or together with software distributed by one of Monotypes licensees. This software is a valuable asset of Monotype. Unless you have entered into a specific license agreement granting you additional rights, your use of this software is limited to your workstation for your own publishing use. You may not copy or distribute this software. If you have any question concerning your rights you should review the license agreement you received with the software or contact Monotype for a copy of the license agreement. Monotype can be contacted at: USA - (847) 718-0400 UK - 01144 01737 765959 http://www.monotype.comhttp://www.monotype.com/html/type/license.htmlNegretaArial Negretatu nArial tu nfedArial fedFettArial FettArial Typeface The Monotype Corporation plc. Data The Monotype Corporation plc/Type Solutions Inc. 1990-1992. All Rights ReservedArialBoldMonotype:Arial Bold:Version 2.76 (Microsoft)Arial BoldVersion 2.76Arial-BoldMTArial Trademark of The Monotype Corporation plc registered in the US Pat & TM Off. and elsewhere.Monotype TypographyMonotype Type Drawing Office - Robin Nicholas, Patricia Saunders 1982Contemporary sans serif design, Arial contains more humanist characteristics than many of its predecessors and as such is more in tune with the mood of the last decades of the twentieth century. The overall treatment of curves is softer and fuller than in most industrial style sans serif faces. Terminal strokes are cut on the diagonal which helps to give the face a less mechanical appearance. Arial is an extremely versatile family of typefaces which can be used with equal success for text setting in reports, presentations, magazines etc, and for display use in newspapers, advertising and promotions.http://www.monotype.com/html/mtname/ms_arial.htmlhttp://www.monotype.com/html/mtname/ms_welcome.htmlNOTIFICATION OF LICENSE AGREEMENT This typeface is the property of Monotype Typography and its use by you is covered under the terms of a license agreement. You have obtained this typeface software either directly from Monotype or together with software distributed by one of Monotypes licensees. This software is a valuable asset of Monotype. Unless you have entered into a specific license agreement granting you additional rights, your use of this software is limited to your workstation for your own publishing use. You may not copy or distribute this software. If you have any question concerning your rights you should review the license agreement you received with the software or contact Monotype for a copy of the license agreement. Monotype can be contacted at: USA - (847) 718-0400 UK - 01144 01737 765959 http://www.monotype.comhttp://www.monotype.com/html/type/license.htmlNegritaArial NegritaLihavoituArial LihavoituGrasArial GrasFlkvrArial FlkvrGrassettoArial GrassettoVetArial VetHalvfetArial HalvfetPogrubionyArial PogrubionyNegritoArial Negrito>;C68@=K9Arial >;C68@=K9Tu nArial Tu nFetArial FetKal1nArial Kal1nKrepkoArial Krepko#mArial #mLodiaArial LodiaNegritaArial NegritaNegritoArial NegritoNegritaArial NegritaGrasArial Gras &&~ #~ O\_ :Rkmq~    " & . 0 3 : < > D o  !!!!"!&!.!T!^!!"""""""")"+"H"a"e###!%%% %%%%%$%,%4%<%l%%%%%%%%%%%%%%%&<&@&B&`&c&f&k:1 6<>ADOY}b?  #~Q^ !@`mq~   & * 0 2 9 < > D j  !!!!"!&!.!S![!!"""""""")"+"H"`"d### %%% %%%%%$%,%4%<%P%%%%%%%%%%%%%%%&:&@&B&`&c&e&j: *8>@CFVz^>/wkri+*)(i3][w}ujy,ߨߖޖޢދަq_0@3$FE<9630)"ۿ۾۷ۥۯEBA$"!9>c$FxFJXZV^^HHJF ^bcdefghjikmlnoqprsutvwxzy{}|~      !"#$%&'()*+,  -   ./0 !"12#3$%&'()*+   4NORPQUVWXST~?Avw|qrsYZ[\]uwvyx}  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&&~ #~ O\_ :Rkmq~    " & . 0 3 : < > D o  !!!!"!&!.!T!^!!"""""""")"+"H"a"e###!%%% %%%%%$%,%4%<%l%%%%%%%%%%%%%%%&<&@&B&`&c&f&k:1 6<>ADOY}b?  #~Q^ !@`mq~   & * 0 2 9 < > D j  !!!!"!&!.!S![!!"""""""")"+"H"`"d### %%% %%%%%$%,%4%<%P%%%%%%%%%%%%%%%&:&@&B&`&c&e&j: *8>@CFVz^>/wkri+*)(i3][w}ujy,ߨߖޖޢދަq_0@3$FE<9630)"ۿ۾۷ۥۯEBA$"!9>c$FxFJXZV^^HHJF ^bcdefghjikmlnoqprsutvwxzy{}|~      !"#$%&'()*+,  -   ./0 !"12#3$%&'()*+   4NORPQUVWXST~?Avw|qrsYZ[\]uwvyx}llll0 " @ < hTH..>!"H#2#$%&'.')~)+-./p1 2n45D6$7>9$:x;n<==r=>>?$AB CHD8FDGDIJJK~LMNOPQRStVfWXnY[]v^`\aac"cd,d\dde&eveef$fTffg gNgghhHhhii8iijj0jrjk kDktkl lnRoqqrsuwxyy^z>{p|~~lJ^0j."|8:FdNL|*:Xb\&` Db| f6Z&P"2:,`~|2vIJ0bŔ2~.dɢɺ\ʌʼ˸j̞N͜<xδ"RςД"` Bz԰.t$0hݒ @>h(\ (Hh@pLv.dP:nFnh ((hpvxvL(RnN~Br2b"Z    L z       Dr0.^L|>RBrxF(&VHx@p~ f"$n&(8()).)+,h->-.01t11122222233344556 66*6:7 8&8Z88899L9:j;`<@= =>?N@bA&A6BBBRCCDEFGGHH@HpHHIIK KK*K^KnLtM`N.N^NOOOOP<PPRSTU.VXVVVWWTWdWtWX|YzYYZ[ [\h]P^ _4`Zaabcdddfh$hhjjklJlZlllmNm^nnoLophqqrstuvwx<xjyyyyyz{|} }:}~8~~bxx\*n(r2nNd^VJr>|x<HjnT`*`HvTvnZ82fBRHRbZbÌbǼʬ˘`>πѬ:tԒբ Jt\؆ذ.Xق٬ 4^.>hݒݼ߀Xh4 H2\.X*T~dLN.R fHHr  D n     @ j     < f     8 b  $  PZ\>8H!#8$$%l&'T'd(0(@)+-.->.:.J//012>34457J789H:;;<<==>`>p??APA`BBEJEZGjGzHIJ2JBKL MMNOOO.PPQQRnSTUWFXZ4[z]<]L^`aacne g8gHgXghhhiijjkkmm"mmopvqsttvHw~y{V|\|l~@BZ"L\l 4^n~2\.X*T~&Pz"LvHrDn@j<fFpBl>h:d 6jFd$X*n2$f0FPBr,>PbrRª NØ.ĆNŤ&x4ǠLȌ6Ɋɰ0`ʐ:xn̲N͎ʹ6\΂ΰ$πϺRЦ.pѰ&bҞ4dӊӰ&PԐ"ZՄծ4Zք֮Brע0`ؐ$لٸPڰHި$ " 08! v0$""!~0cb"%!!%!4/e /84!!!#/4).c"[O"%ecee%"." !8/.."%%../10404$!.#.#/~~0404".".$.2222+1 1%.. ! ! "04048%8%8%8/!e. /044$!$!.#/~04040404cb/%"cccb%."08.v0$."~b8b4%4 '4%4!4%4!4H18!  .)00 v0$".~!%!+F1C!!)4+//e4'  $ +1T TTTT $11 +1T   ) ,,'X+**'     ,  , *))* ,,**,, ***'/'     + /%%%%%%%%%%%%8/8/$!$!$!$!$!$!$!0404     bbb%8/$!0404040404    !" # $"%#&$'$(%)&*'+(,(-*.+/,0-1-2/30415162738495:5;7<8=9>9?:@<A=B>C>D?E@FAGAHCIDJEKFLFMGNIOJPKQKRLSMTNUNVPWQXRYSZS[T\V]W^W_X`YaZb[c[d]e^f_g_h`iajckdldmenfogphqirjsktlulvmwnxpyqzq{r|s}t~tvwxyyz{}}~   !" # $"%#&$'$(%)&*'+(,(-*.+/,0-1-2/30415162738495:5;7<8=9>9?:@<A=B>C>D?E@FAGAHCIDJEKFLFMGNIOJPKQKRLSMTNUNVPWQXRYSZS[T\V]W^W_X`YaZb[c[d]e^f_g_h`iajckdldmenfogphqirjsktlulvmwnxpyqzq{r|s}t~tvwxyyz{}}~   !" # $"%#&$'$(%)&*'+(,(-*.+/,0-1-2/30415162738495:5;7<8=9>9?:@<A=B>C>D?E@FAGAHCIDJEKFLFMGNIOJPKQKRLSMTNUNVPWQXRYSZS[T\V]W^W_X`YaZb[c[d]e^f_g_h`iajckdldmenfogphqirjsktlulvmwnxpyqzq{r|s}t~tvwxyyz{}}~ɽ2@2@APMMoK-12K 2A  @2@2{042{2PAxen#~ncnbd @2A??)A2Du2u(*2A C2 42 @@ 2@2 / T 2A TTnn@n 2A EkF@ 2@>3@> 2A >&82A&(0( 00Po0/zpwwz2$(22 2@2 2?sOs@t2o*@,2@p 222A     г 2@ҳ 2A_02?d3!!@ 2ò+/2ò%2ò2ò2A%$"t5;5;8P/&&$5tA X7 @7@%@-@0%0-0 % - 7 A7 0@7Atttt`tpttttt?O~z{|}tuwp~ppppzp{p|p}ptpupw`~````z`{`|`}`t`u`wP~PPPPzP{P|P}PtPuPw@~@@@@z@{@|@}@t@u@w0~0000z0{0|0}0t0u0w ~    z { | } t u w~z{|}tuw~z{|}tuwA~z{|}tuw0t@t~z{|}tuw~z{|}tuw~z{|}tuw~z{|}tuw ~    z { | } t u wX)~}|{z7w&u t7A5O5_5o55555555@"OO A _5555/5?5?4O45544@ *****A G 7X@ &>&>7&'>&6&6)@+&6&6&6&6&67&62&6-&6%&6&67&*X@"&>&>&>'&>!&> &>7@  '('0'O'bA ' 4]'.['A UTSRVQ)+'&A *'%)X%$#;"9A '-X@  %V@ -AA XXX%X%.-)X @0t-sJaR]%\YXP%I%G%@ Fy@'9 8X7-%2X%,4*%U7@*[B;#"  @+JKKSBKcKb S# QZ#BKKTB8+KR7+KP[XY8+TXCXYYv??>9FD>9FD>9FD>9FD>9F`D>9F`D++++++++++++++++++++++KSXY2KSXYKS \X ED EDYXpERXpDYYKS \X ED'EDYXB ERX BDYYK%S \X&ED!EDYX &ERX& DYYKS \X ED EDYX%ERX%DYYKS \XX&ED&&EDYX# XERXX# DYYK)S \XED-EDYX ERX DYYK/S \XED%EDYX5ERX5DYYKS \XEDEDYX(ERX(DYY++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++eB+1u~Ee#E`#Ee`#E`vhb ~uEe#E &`bch &aeu#eD~#D 1Ee#E &`bch &ae#eD1#DETX@eD1@1E#aDY?CX;!~ +Y #B #BCX-A-A +Y#B#BCX~;! +Y#B#B++++++++CXK5QK!SZX&&E@aDYY+++++++++++++++++++sssssE@aDEiDEiDssstssststst++++++++++++sssssssssssssssssssssstttttttttttttttttttttuuustuuuu+sK*SK6QZXE@`DYK.SK6QZXE@`D E`DY+EiDtsss+EiD++C\X@ t2owww/12w"%2@t/52@t(*2@t!272%2@-2%-7%-72/t+s++++++++t+stY++C\X22++Y+s+++++++++++++++++++++++++++++st++++++++ss++++++s+s+++t+++sssss+ss+++s++++sts+s++++u++++++++u+++++s++++stu++sss+++@@@?>=<;:987543210/.-,+*)('&%$#"!  ,E#F` &`&#HH-,E#F#a &a&#HH-,E#F` a F`&#HH-,E#F#a ` &a a&#HH-,E#F`@a f`&#HH-,E#F#a@` &a@a&#HH-, <<-, E# D# ZQX# D#Y QX# MD#Y QX# D#Y!!-, EhD ` EFvhE`D-, C#Ce -, C#C -,#p>#pE: -,E#DE#D-, E%EadPQXED!!Y-,Cc#b#B+-, EC`D-,CCe -, i@a ,b`+ d#da\XaY-,E+#Dz-,E+#D-,CXE+#DzEi #D QX+#Dz!zYY-,-,%F`F@aH-,KS \XYXY-, %E#DE#DEe#E %`j #B#hj`a Ry!@E TX#!?#YaDRy@ E TX#!?#YaD-,C#C -,C#C -, C#C -, C#Ce -,C#Ce -,C#Ce -,KRXED!!Y-, %#I@` c RX#%8#%e8c8!!!!!Y-,KdQXEi C`:!!!Y-,%# `#-,%# a#-,%-, ` <<-, a <<-,++**-,CC -,>**-,5-,v6#p 6E PXaY:/-,!! d#d@b-,!QX d#d b@/+Y`-,!QX d#dUb/+Y`-, d#d@b`#!-,&&&&Eh:-,&&&&Ehe:-,KS#KQZX E`D!!Y-,KTX E`D!!Y-,KS#KQZX8!!Y-,KTX8!!Y-,CXY-,CXY-,KTC\ZX8!!Y-,C\X %% d#dadQX%% F`H F`HY !!!!Y-,C\X %% d#dadQX%% F`H F`HY !!!!Y-,KS#KQZX:+!!Y-,KS#KQZX;+!!Y-,KS#KQZC\ZX8!!Y-, KT&KTZ C\ZX8!!Y-,F#F`F# F`ab# #pE` PXaFY`h:-&ii( 1IT$UI+v=7NUUeY ;Ra|<AA* ci"+&Y+H!kk ]CIVnwP{(ai5M >[[[? 2 &1=NVbHSw &(~~.A]kuJb d#%*t 0Pjo&NLz8h "OpN5Bka&Fi+8;Z^hs";DOor~"6q&.1OZ22GS<dp*hYz!'+9FKMW\e"+ASae#+1IZ[nqt~uzLmm/j6Pp*  +S?hn@t5=`n!&B<Vkxks:}7S< Ind^9 |+YUa( ]&l7>z&Bi7-  thGhG\H (2APZd}yo ,\<Gd%2v1x  cB,4A8HXlYCp(7BPZdsx\,cAKU_s Ad*8t,@  ,;DVcWd6PFND$B"`9,N8iT=qAPO5R,99pssFYZ\kCU9us99sVss3sMs&s[sWsWsSsA_U_j=aV9b9s#9YV9YVJ,VVV9&ss*sIsUTsAT99s9~R[s0s 9 s s"<=-CaV9YsIsIsIsIsIsIsWsAsAsAsA9999RRRRRsD3VsTs s;Bsd19?d2d<d<so,zd1%%7XWeUdTsds`sj9YHXsi99rd1/sVVsKKsD99uqVVV9j9999Y9Y9Y9&` 9 VJs0"=SVsVUm[(\\(s9bT9VJs0asUasUTksIsIQVsAVsA9y9YRPVJs0,,""9VVNNNyN0Nk+O)OOOjUU"~~~~~~f0 0 *+kUo@:@7?@%UGs#\\MsIasUasUVsAVsAVsA9bT9bT9bT9999999n9us#9ss99YR9YR*VJs0,9 Vs9sIX9?W9 9 9 Vs9s Z\)0/&?k9)V9V&f9YVZ,VVyVjb9VNN9lsNSN9vss NRv)NvvN9vNvNZ/XVJ95s#7V;, 9YVa,YV} 'W@sI\UsARsUsTs r(k8sEUkQs09@9@sA 011~!}eYA f2/NZ}/,(KA 7/KPY dd  ,(Zc-^^^6P P/,(,(y2ZZZZYYYA f2},(KA 7KPdd ,(Zc-/AKdA%QC~FFFFHFFQF~~P~~~-~~~~~55X~~~F22,,4x000vPvPooVooV(o0FF@FQ s-g.~ ^ALL^`(0,,`22,,6R@22,,22,,4x0004x0004x000vPvPvPvP2222,,}},,00000000T4FTT4FTuupmmpToToiiggRRTT,,XR@LL(o(0,,T"T"T"TFFQFFHFFFFF@0FFYR_1U&ipx\EU_%6pTY~4PF>:&/v9sIsIsIsIsIsIsIsIsIsIsIsIVsAVsAVsAVsAVsAVsAVsAVsA9j9]999YR9YR9YR9YR9YR9YR9YRYRYRYRYRYRVsVsVssI999YR                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           "                                                                                                                                                              "               &                                                                                                                                                                 &            *                                                                                                                                                                   *                                      0                                                                                                                                            0                         6                                                                                      6:                                                                   : @                                    "    !"                   #" !!    $                     """"          @    !B                 ! #  !#!   !             &!!! !!!!!"#        #          $#!" " !%                 !      ####         !B   %J !   $ #     !    % % ! %%#%   '         '%%%$%%%%%&'" !      # %! ###   ""      ! (' !!%% $&   $"%)               ! ! %          !!!!''''          %J         *T #   )! #!!'   %! ! **!#  %*!*(*  + !!!   ###!  !!" /***)*****+,'  ! %!!!   !!'! *%!'!'!'! ####$&#'#  #!""    $ $% .-%&#!$*+%)+$""$$ )&*/      "             % % *       &&&&-- --          *T$###  !!!!!!!$$$$$##### !.\# *!   -!!!$ !% $$! +   (# ! $  ""..$!!& #).$.+.  + $$$   !&&&$ !!!!!   $!!  $$ 0...-!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"...../0*###$! )!!$$$    ! !$$!    +# .)$+#+#+# &&&&'*&+' !! !% $!$%   "& &)! 21(!!!(  % $!!&" ./(-!!/! !(&'"'' -*.3#      &     ######## ########### #####(#(################ ##.#############################       ))))11##11####   ## ### ## ### # ##############################################################################.\'!&!&&  $$$$$$$'!'!'!'!'!  &!&!&!&!&! $     2d&*$ 1#$$$!'$ $)$'!'$! $!/!!,'##$!$'$%%22'$$)&,2##'2/2!4#!#!! '''$$$!$!!***' !$$##$$$!!$$'$$!  $$''"$72221$##############################################$2111135.&&!&'# ,#$$!!!'''$$    $$$''$! $$$$/'!#2,'/'/'/'!****#+-).*#$$!$ $!)$ '$! !!'( !'++!,$! 75,$#$$$!-$$#)$'$!$ +!%#33+1$$4$ # #+'($++0-28&   #") #### #"  &&&&&&&& &&&&&&&&&&& &&&&&,&, &&&&&&&&&&&&&&&& &&2&&&&&&&&&&&&&&&&&&&&&&&&&&&&&#     ----55''55''&&   && &&& && &&& & &&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&2d+$)$**############!!!!!!!!  '''''''+$+$+$+$+$$$)$)$)$)$)$!!!# '$$$$$6l)0'   !5%'''$!*''!-'*$*'$ '$3$#! !!!!/!!!!!+ %%'$'*'!!!!!!!!!!!((66*'',)0!!  6%%*636# !!5%$%$$***'''!$!'!#$! ---*!$''!%%'''$$!!!'!'!*!''$  '!'!!! *)!!%%!;6665' ! !!&"&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&'!65555!!!791))# )*& 0!!%''$$$*!*!*!'!'!'!'!'!*!*!'$ '!'!'!'!3+#%60*!3+3+3+# ----%.1-2-%''$!''$-'#*'$ #$)+#!!!!!!!'+!+$0 &$;9/!"'%''&$/"''!&-'*'$' "-$'&77/5'&8'!!"'!!")!!!!/!--'.!. !41!"6<)!!"!"! %$,%%%%!""! %$ ! )))))))) ))))))))!)))##)))))/)/#)))))))))))))))) ))6)))))))))))))))))))))))))))))&   # ######11!!11!!99**99**))!! ## )) ))) )) ))) ) ))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))6l.&-'--%%%%%%%%%%%%$$$$$$$$*!*!*!*!*!*!*!.&.&.&.&.&'!'!-'-'-'-'-'###%*!'!'!'!'!'!:t, 3*" """#9)***'#-* *#1*-'-*'#*'7'&#"  # # ## 4#### #- "))*'*-* ##########   #++: :-) !)0 -4##" # :))-:7 : & ## <)')''---***#' #*#&'#""000 -#' * * # ) ) ***' ' ###*#*#-#**' ##*#*####-.$#(( #@:::9*"#"##)$)))))))))))))))))))))))))))))))))))))))))))))*#:9999###;=5,,&",. )3##) * * ' ' ' -#-#-#*#*# * #*#*#-#-#*' #*#*#*#*#7-&) :4-#7-7-7-& #0000)15061)**'#**'1*%-*'##&'//&$#"#!# !##$"!*0"#"0'3#)' ?>3#$))**!)'2$**#)1*-*'*#$2'*)8929*)<* $$% *$$%+#### 2 $"00*2$ 2" # 85#$:A,"! $$$#%$ ""!)' / ))))"""! $$%$""!)'!"#  !!!!!!!!!!,,,!!!,,,,, ,,,,,,,,$,,,&&,,,,! ,3,3% ,,,,,,,,,,,,,,,, ,, :,,,,,,,,,,,,,,,,,,,,,,,,,,,,,)  %! &&&&&&! ! ! 44##44##>>-->>--,,$$% %!#,, ,,, ,, ,,, , ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,:t1)0*00) ) ) ) ) ) ) ) ) ) ) ) ' ' ' ' ' ' ' ' -#-#-#-#-#-#-#1)1)1)1)1)*#*#0*0*0*0*0*&&&) -#*#*#*#*#*#C2 %%;0'%%%%%%%%%%''')A-000-)40%0)904-40-(0-A-,)'%%)%)%))%<))))%)%5%""'--0-040%%%%%%%%%%%))))))))))%%%%%)11C%C40%%%%'!07%3<))'%%%)%%C--4C?%C""%!", %))%"@-----444000)-%)"0),"-)''888%4)-%0%0%)%-%-%000-%-%))) 0)0)4)00-%(( 0)0))")"(45)) ..%(HC"C"C""B0'('((/*/////////////////////////////////////////////1(CBBBB(((DG=22$,(""25%/ ;!((-%0%0%-%-%-%4)4)4)0)0)%0%%)0)0)4)4)0-%(0)0)0)0)A5,"-%C<4)A5A5A5,"%(8888-9= 7>8-00-)00-90+40-((,-56,) )')%)$%%)%))#''18')'8-;(0-%IG;)*0-00&0-;*00)/9040-0(*9-1/CC:B00E0%))+%/!))"+2()()%":%)'6819)%9'%)%%A=)""(!CK3''%))*#!!)*)$('!"-%%%"7##!!%1111''''%)*#!!*)('"-'!')    &&&&&&&&&&##222&&&2222222222222)222,,2222'%##3;$3;$+%222222222222222222%C22222222222222222222222222222/+',,,,,,'%##'%##'%##<<))<<))GG44GG44########$$$$33))$$$$+%+'$(!$!$!$22 222 222222 222222222222222222222222222222222222222222222222222222222222222222222222222222C9081"88-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%-%4)4)4)4)4)4)4)90909090900)0)8181818181,",","-%4)0)0)0)0)0)K8$**@6,**********,,,.I56662.:6*6.?6:2:62.62G22.,**.*.*..*C....*.)<*&&,55626:6***********..........*****.77K)K:5)))*+%5>):C..,)*).**K55:KG*K&&)%&2 *..*&J52522:::666.2*.&6.2&2.,,???*:.2*6*6*.)5*5*6662*2*...$6.6.:.662*..$6.6..&.&-::.-$3!4)-SK&K&K&&I6,-,--5/5555555555555555555555555555555555555555555557-KJJJJ---MOE88(1-&&8;*5$B%--5*6*6*2*2*2*:.:.:.6.6.*6**.6.6.:.:.62*.6.6.6.6.G<2&5*KC:.GF?5662.662?60:62-.22:<2.$.,.)#.)*).)!..',+6>,.,>2B-52*RPB./7566+52B/66.5?6:626./>275LMAI65M6*..0*6%..&07-.-.*"&B*.,>?7@.)@,*.)*ID.&&.%"KT9",+")../'%%./.)-,%&+'63)))&=''%%*6666,,,+").!/'%%/.-,&+'63+%,.# **********''888***8888888888888.888118888+*'' 9B)9B)0*888888888888888888*K888888888888888888888888888885#""0+111111+*''+*''+*'' CC..CC..PP::PP::'''''''')#))#)99..))""))#"""0*0+)-$)$)$)88888 888888888888888888888888888888888888888888888888888888888888888888888888888888888888 K@5>6&??5*5*5*5*5*5*5*5*5*5*5*5*2*2*2*2*2*2*2*2*:.:.:.:.:.:.:.@5@5@5@5@56.6.>6>6>6>6>62&2&2&5*:.6.6.6.6.6.S>'..I< 0..........0003Q9<<<73A<.<3G>,61**>A.;(I)229.<.<.7.7.7.A3A3A3<3<3.<..3<3<3A3A3< 7.4<3<3<3<3OB8-9.SJA3OBOBOB8-.2EEEE'9GK'DMF9<<73<<7G<5A<72487DC83'303/&3-./3/%33+00@H030H7I2;7.[XI34<9<>>///>>>>>>>>>>>>>3>>>66>>>>0.++$$?I-?I-6.>>>>>>>>>>>>>>>>>>.S>>>>>>>>>>>>>>>>>>>>>>>>>>>>>:'%%6066"66660.++0.++0.++$$$$KK33KK33XX@@XX@@++++++++-'--'-??33--%%""--"'%%%6.60-1(-(-(->>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> SG;E<+EE9.9.9.9.9.9.9.9.9.9.9.9.7.7.7.7.7.7.7.7.A3A3A3A3A3A3A3G;G;G;G;G;<3<3E222.K00..3CCCC6665*39(:0-.:#876/50C>5-68!+444444444400EE E444EEEEEEEEEEEEE8EEE<<EEEE5300((FQ!2FQ!2;3EEEEEEEEEEEEEEEEEE3\EEEEEEEEEEEEEEEEEEEEEEEEEEEEEA+**;5<< &<<<<530053005300 ((((SS88SS88bbGGbbGG000000002+2!2+2!FF8822!!**!!&&22 &+***;3;527-2-2-2EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE \NALC/MM?3?3?3?3?3?3?3?3?3?3?3?3=3=3=3=3=3=3=3=3H8H8H8H8H8H8H8NANANANANAB8B8LCLCLCLCLC=1=1=1?3H8B8B8B8B8B8dK /88XH!!':!8888888888"":::=bEHHHC=NH8H=SHNCNHC=HC_CB=!!:8!8=8=8!==8Y===='8!=6P852'':EEHCHNH88888888888==========8(888#8=JJd!!7dNG7778:1GR7%%MY==":787=88dEENd^8d22715B8!!==82gECECCNNNHHH! !!!! !"!=C8=2H=B5C=::!!!SSS8N=C8H8H8=7!E8E8HHHC8C8=='=0H=H=N=H'H'C8=!=0H=H==2=24::LV:=:VCYFEHH9GCX?HH=FSHNHCH=>TCIFbdWbHGgH8>=*?8H2==2@I<=<=805V8=:RSIU=7U:8=*78a[=25=1-doM!!!!!!!!!!!!!-!!!"::.7=)>?412=?'=6;;2394HC7772R44228HHHH::::-7= ,? 412?'=;;394HC:1;= $/88888888885 5KK"K888KKKKKKKKKKKKK=KKKAAKKKK:844++LX$6LX$6@7KKKKKKKKKKKKKKKKKK8dKKKKKKKKKKKKKKKKKKKKKKKKKKKK KF/--@:AA"*AAAA:844:844:844""""++++ZZ==ZZ==jjMMjjMM444444446/6$6/6$LL == 66$$--$$**66"*/---@7@:6<161616KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KKKKKKKKKKKKKKKKKKKKKKKK dUGSH3SSE8E8E8E8E8E8E8E8E8E8E8E8C8C8C8C8C8C8C8C8N=N=N=N=N=N=N=UGUGUGUGUGH=H=SHSHSHSHSHB5B5B5E8N=H=H=H=H=H=B?@ & +<  @4 @$&4?   N!> 0@`N |+]<<<]r++<<<?<<@fv@ 0MC+N]M?M99910rq5!52.kQhF@(  " "@ 0k+]??<<10]#&5673ecVg=5#Q!WfCQ@I@'' gg  " " jC+??<<10]>543ESD:fBKQu/@%UVEF  +&@  @+  >@'4>r @4O_>@@4O_>r @4> > ?  |+N]qM+]+]++?<]999910]]]'6767&'&'7&536767'HNvU;gBZL5ox$=uQJ 5@gI))elUV B@ b0@7bb @bO MC+N]M<</]<<10%!!!!!}}u ?   @8 r&$ 0 gv+N]M?M99910!'667#*uZ7UHzp tbUAi2@!0@7 0D 0l+N]M]/]10!A($@8 & 0gv+N]M?M103!;8@I l+NMNM?32#"$M rQWwrR6KrxXIHf my}g~!hnpj|iWJXd`,[ls&D @9 9  + S k  %( H [     @    @  ( X  @?LH+Nq]M]<<??<]<99999.+}10]]]+!!533#~|춶'^ [5@) 7EI  !# @    0@PV 4 Z@  /  @4 @ 4 0@@//?O@4@@!@ w@ӹG+N]qMN]qM<?<+]q<]++q?+q]q9.+}99910q]%32654&#"'!!632#"$[ vMXzyay`,^biy_ok!/ٵW*#@;j u 6Dz @4 !/!!@4!@  O!@"/@4wO  %$+NMNqM?+q]]+q?+q99]10]]&&#"632#"3232654&#" TCY{i*~QNhpTQpSTP|Yd鉕zW @14  :8 HV !   / / ? O  @4  X/`@O  +N<q#$H%(0A#$Ka;3a K!$ +\A 0HH(k@0a> 0P>b7a Ojl+NMN]M]?<????9999999910]]%3! $$!2!"&'#"&5476327!327654! 32$327676654&#"d  )ϝSTvۄU0Lf~X0gL92&%5MiPVJs:8ro3D:LKo x+=eqy 2@ 794(794@ (54@(54@P!'4(!'4)**( / 87? jjefhg J       @> @ 4 % @ a@  0$@  0  $a@  ^c+N]M]q]qNEeD?<<54&&'&#``-7fMb(|7H_<&εcK*5VŪf @=%0 % % KH   0 @    0 1S+N]#г>#9"9#ɲ9"@9 9 9 9"@ 9 9  9 9+++++++++++++Y10]q]%32654&'&'&'&54663 &&#"# J =L4`}}I/,8uyQ4I.;Vypf qc5"94%/fm~k,r@#/ 00P p % -@  0-@Pp+N]KQX@8Y$@8  GG W V % @"@P`p 0 01u+N] 5     Vg@    0f ^c+]<<??<<<99999.+}ć.+}<10]+!!![YRUiQD @9 *%&@% Hp  @% 4 @ P `  0@P`R +N]#2N@hJHI% 6FW&fg&&  ')Yw 4$21, $@+.4$@"(4$@4o$$$F@04=,3@4U!@?!@?!@4!t ,?,?,4,t@@ 1&) ( Y    @4 O44`03)!_O_o3iA+N]qrMq]N]+]qrM<?+++?@QXYYhii}y 88JJFY i :77ww 443 4 4  t@ @4@43t@ @4!/ @4 !O!XA+NMN]M++?]++?++++10]qq]&&#"3267#"321cOi}kPf+2ST[o/&%Ta@-YY YVVY p:4 :4JD JD t t@  ) &)@!X<+NMNq@F 9  HGF O   @4@4??@ P`43 4")4+-44@4_t t@$ !/!O/_o!@ 4iA+N+MN]]M?C\X@@(?@?@?@?++++Y?C\X(????++++Y]q+++++C\X99 >A!?++++Y+9]C\X@@?@?@?@?++++Y/<++r++<310]q]+# '&532!326&&#"6i@aBZ'xV\<<R/+}HlzCCs@26*  Y  _  t@ t@ 3?OP(/_@ &_ 4xi+N+q=5&PS$9QKITQ`>#/2@`w p1 1 ##033@CCYYY%V)V+Y/; 3;(3,K DK(D,   * '- $43> >(*4#%4144@ 4`_t't -t@ *) &)@ 11@ 3$!0X<+NMNqp`gheF'8!1#^ Gj<Y@+933BB $Xht@   & @ $4   @"$4p&@ $4?<+Nqr+';)@] ?  4444#DEED# /)S `)))  ))))/)P)))))@4?)P))))!t !t@'&' &@Z5`oF@&@Z5o`F%&&')' ?'@6 ?'@Z5'@A5'@<5'@$'4'@:=4/''''''' '0'''(<+N]qr+++++++@Zh44DDt@   &@ $4@"$4p & ) @ $4   ?<+Nqr+ @H YVVY    ut t@9`p!XA+NMNqM??10q]]qCX@ iffi]Y]]4632#"$&%32654&#"R4 nnnn"Äl>@.8H49 94DI ID VV YVVYtt@ !p)&)@ p?A+NqM<<NqM?@7<4 4<JD DJp4YY W VYYV   t t@ !)&)@ X<+NqM<<NM?@( Sfu/Xhp    ? O  w@)  (  0 p  _&)@ ?+Nq*n@#'#'* F !# ") U e " A#@$D&g"d&"$ 7&EF J OF!B""$'&7 5!5"5#5$  ! ' """#$"@,s xyv)u***"# **,"˳(*4!˳(*4"$4!$4"4!@4k 6"F" """!" 43-? >"%4@40@P`P`4@p_F( @43@-?@ >@574@+.4@%)4@4_oU@"$4PF!@!#4@43!P%%%@4%,@ ?P,0,/,,!03! ? ?@ 4+x+N+++MqN]qr++qMqr++?]q+]+++++++?]q+]qr+++++9]q++++++10q]qqqq]]C\X$@ ?( ?! 9  9! 9" 9++++++Yq]%327654'&'$'&54632&&#"#"&0ncm7%I[~(_Xo0 &YX/+RU(/ K>V1>B#fJKҰ@) # ):JY   @`tt@ / //_@(&U?` 0x+N]qrK7SK;QZX8Y FGGHI wxwx x w     -@ :4&:4 @ :4 &:4 @ :4&:4:4@ :4 @:4  M L@2      /?A  m m@  Ĺ+NMNEeD]?<<7654667633"3#".54'&&?c{P+"[m.B4+d7PEQL@ P@P44@Io+N]q7>7&'&'&'.#532IJ5 #^[=5kB,I9J"/ Aq5b#Z\$U@0vš]3zh}W!0.BfFK2*e8PECi@:   )9 6 69 * $$* 0@70 @  7+ @!0@7+0@7    jk+N<]</M]]]]10]]]]6323267#"&'&#"C?j18F.X2_gXoEK0T-C&$z,'@O/ ^H+4)++]q55&$@  H+ )++55a]^&&"@""""`"""$H+*)++]q59&(Rf,@ O CH+4)++]q5# &1V-@@4@4@ 4H+4)+++++q5Y&2,5@/@oH+#4)++]qqr55$&8,)@o!!!O!!TH+!4)++qqr55I.&D@O6 666H+65)++]q5I.&DC@ 4H'45)++I.&D@ 8h+75)++5I.&D'@::/:::YH+:5)++]q55I.&D(@333/333=H+D5)++]]q5I.&D@ 6H'65)++U]?>&F*!_!!4!@ 4! 'H+))++++]5A'&H1@  O   @ 4 (H+ 5)+++]qq5A'&HC@? H+5)++q5A'&H@ " h'!5)++A'&H+@?_ H+5)++]]q55~C&$@4@ 4H+5)++++5&C'@ 4@4H+5)++++5r&$@ o    |h+5)++]q5p& @   H+ 5)++]q55Y&Q(6@p ,H+(5)++]]qqq5R&R-!@P`2H+5)++]q5R&RC!@@ 4 H+5)+++]5R&R @ h'5)++R&R'@!o!!!!YH+!5)++qr55R&R)6@pBH++5)++]]qqqr5S&X'/@oO_P`6H+5)++]]qr5S&XC@H+5)++]q5S&X@ #h'5)++S&XwH'5)++D# F@, /?O8 8 8_ jC+N]qM<</<]&&@n%%9JHK&W WXh&&w789%+$&:: & %   %  33!t3t 3 o@ _/?O!//?O! 0 4( o $$!@ 4'X{+N+M]N+]M]]????.+}99<<<<<<<<10]]]]]3267#"''&532&'&#"Og+23uzt-1q{pC j}L+[o/~"<$x#H2H^V S6@(  733z,,8H &+&%%t@ ('t@ P//t/5 +5t 8@$8&'* *85"  7|+NM]]<<;+7.(yy7S(S>p>p((>(7>"7"4(5(J 7J7j7.(>7"4;+ 1@ \\1"@% 4>8?Oo577B8>(@.5>>(((((Ajk+N]M]]NM]]]+?/9qqq]]]]]999]910]]]]]]&&#"#"&'%32654'&&5467&&546326654&'%OFAD.\8WK[[=<eMBN%&7Z_23ӿ,+.g"4JN9$1-0IW]@8Gƥ!Z[E1/%%#wb66p: (I"!FKJ*e[B  m2 jk+NM/10#"&54632z{{z{zzmiW~@ I IO`I l+NM<<q<<<?<<9910#&&5466763!###{R^8Uqmزif H3@)=Y ]X"#)+#+$'#t -t@ 3 `@%_o(I%%! U*!o@!P55523Y4?A+Nq4)7H8C@y9 966O3O4*& ++v&y3}4h43ggh6Z4g699)49604+1:9E6778BCE"p!!1228   >@ (((((K2@ ?1p1111&@ EC8!  & D^J+NM]<9%*7 m s { S [ c  K @ P  ~@   @@4`@4 4++]<<++<<?<<<<<<99910q]]]]]qq#5!#!!!##Y[34ssC@ 4 $4PY@ an|+NM]?]q10++!;+6@ϰ _ !l++N]MN]M?<<105335312@_        s0@7  ?O7   Jk+NM<<?E > @"EE2*E1gv+N]MNM?9999+]9+]10]]6632#"&'#"&5463232654&#"&#"3276J_^KLRZA3gdZ.CB/'6KykjzTXXʁ-vW^hH~JBDL$23e @# b0@7 b Z0 @  7 @ b b@b  P  hk+q]<<<<<<?<]<<]<999910!!!!!!d}}<) @_ 4@47G77/@ 0@7   @@ pP jk+Nq]<M<<<<<<<<?<]<]10]++]q5 !)CP<) @7G P 4@ 477/@ 0@7@   @ p jk+N]>@ @  O @&@254@-04@)+4@$'4?@l+]q++++<]<]]<<<]<<<??<<<+<+]q+]q+<<]q+99<<<<<<10]]]]]]q+!5!5!5!!67!!!!!!s4&#4 xxwVP=BKxoi5&g@yy  t@! / &   &+N]0;H@k 0##($#955#IEE#W?e?>$  GYiJ(( WWgv( 7I.# #<;+;1@41111@41+*9*@.9`***6.<@+.4<@"'4<@4o<<vVGd%eD;Y#C5WFJA0S1II=UQ~G )MLAD11111zIiX'8@77I@t=>*:R/#iW_%@z*:' V   {   || '( '@FF LLIKK]   !!%$ 3!t 3t@@ 43$!' @ 4 3!&XA+NM+NM+??9999999999<<<<<<<<10]]]]]]]]q7#"''7&&5432&#"32654hplSY+B",)0V8.wtE(&hiE+@h #(+&) )&&) )#)(%+79 9 769 9#6+(+    #''') 0@7+0 @  7 @0@7+0@7@0@7*+0!@!!7"@!0@7%+0@7 "0""-,|+N<]</M]]]]]]]]10]]]]]6323267#"&'&#"6323267#"&'&#"?jH8F.X2_gX?jH8F.X2_gX[EL0U-CZEK0U-Ck@MhLsL !|++N]]9/]?@$ 8  && & @ ͫ+N]M?<<<210!!!!!!<<9&$Cf@  H+ 4)++]5 &${V,@ @4 @ 4 o  8H+4)++q]++5Y &2V$@ /BH+-4)++]q5H&@U97LY#  | ** )")&/'0'@'_(o(  )) }{ '(@A 5!%/O%%!- - KH( V$7@'  /   ''ҹ+N]]M<#+7j@%3)W.g. HE FX # ?@ ? ?@0 ?+&6F')9I/ 2+$@4$$$$@4$`99'!@ 43` 4")4+-44999_!t/t 't5t@"!/$!99!2@2`22 20222n,! 8XA+NM]]qN]M?<?<+++++++]+9/++]<+r+<999]9]3++++10q]]]]#"&'#"546326632!326&&#"32654&#"1eKOlσoKEleoM"E z\B].xZc:) |hhnU,HLJJ7JJJJDgyFl}P8wmkǥo|!0@}@ l+N/M]105!s|0@}l+<</]105!h q@   8@ 8 @#$ r & $ r  & `g+<<<=5&PS$9QKImJ&M@D /?dd sv  *:JY _  t@  _  tt@! &/?O`6 3(@ &_x<+N=5&PS$9QKIFD#@_ 0@8 /?O8  bbb b 8 bbbb0jC+]q<<<<<<<<<?<<<<]<<QssQQsrR%44%%44&]GP@ '7G&4@#   a   5!C++N]M]NM?]10q]5327654&#"7632#"&gVY+!>A@CNZ}Hamv &"2cnOX7K`g@ 4 $4 4 $4PY@ n@4n+NM+?<]q<10++++!3!`&ȍ**Q]A@Y i y   4 N!gD++NM+??10]73327#"&54ĖJE?Ie]w8XPN+~lS8@ r_l+N]qM?WEc"ݯj_ fTDe$ln@ffYViff VV Ytt@ !)&&?A+NM<<NM?_~\x -@4` `    -@* 4-4@-P-- &  @ 4#{@ - {@   $`@m@ `&&@ 4h/ o@ 4.Mk+N+x+NM]]qqr+]]]<<<<]<<<<9/?_~ .# {@H     %  % %  C+N&V"@ 22_2p2228H+:)++]qr5a^9&&f)@ 0` H+4)++]]qq5U?&F@ O H+5)++]q5a^;&&h h+ 4)++5U?&Fh'5)++T$@ f i$ifiiV Z$ZVZZ@4_@ 4"tt @ e& )@   &&!%X<+NMNq<<&D]%AAA4A ضH+3)+++]q5a;&'h@0"@""h+&4)++]5Q (@1ij"e$e(YVY["U%V(ie96:!4%JEJ!D% N@  &t t@  $#)& )@ @ `  1!)X+NM]q<<<<???&H1+4+~H+)+++5;&(Oh$@ ?O h+4)++]q5A'&H@  h'#5)++9&/f@ H' 4)++y>0&O]$@4@ 4H+4)++++5z  @8 8% $r&K 0P  01+]<yx,tA/#@ 4!4! "P `  N0@W@ ?#O## @`t@ t@ $"#/ / /_@&U@7;4?`@ 4$x+N+qr+#t@$Vexx      !tt @ OA%!X$]3/3/99???3?310]3#&'&'#"5432632654&#"9MF5 {؅}d`z\`}&tH]x$<<]4IXN"~@*jhggh! 87I FXW tPtt@ ! A$!X#3/3/]99]???]910]]!!!"&547&''32654&#" UʁnBؕܮp'qqnOW{e#OpN> @!!4& ZWig t@ t @ 4  t@   @ 4 e!!!X 3/+22/39/3?2/q+9?2/]99/q910q]q]+"327#"&547&54632&#"{V;jݳ4隦gbFG8E3@cPQ}k96&mNI>@' Xiffi:JXVV44tt t@ ! @ 4! X+9/]3q???10++]]]]!#"54!232654&#"IN'KbKrnus&酡0<혮0a&J@` p t@! 0&? 0 9/]]]??<10]!!!!01&=Nll@%@<\SV (:4KEX66FFwO"t /t@4 'A&Po&Po!X&2/q]<<2/q]9/3/??[y&ȩ\{,x"?d,j=}!(@ =4+N<</M105!5!pk&*@ H'H'++O@"vUf5E5@T  O  Ppo ON $   I 0  0  NMC+]qr<]q<<]]qq<]q<//]<<<<10]]]]]#4&&#"#376632.#N%!i:Qt1Sb67%K*>je):C_a@p4[ ZPaD3_E23_1 E 1<78893MNNNR\""I\+ 9:a 322DD_ ;aU$4 4]@ N)MNE1 413**@@@ @0@@;;9:`|+N)A(C~GJ%>u;&<=) A9H*?UTq17Ol3!!#&&'566L;K=;Ol#67!5!&&'VcM^g;L<;l%-0le`_vSh;5367#&&w__elɐ/.%L;g^McVOn#67!#&&'56673!&'3^PE}}EP^^PE}}EP-++-,Ug3&'67#&&'5566-,,-+^PE~~DO^^OD~~EPg3&'67#&&'5566!!-,,-+3^PE~~DO^^OD~~EPbjk3!!jded0"8@*%\ `$"`#gv+<<<</<<32#4'&'.#"] G~yۤH  aPPc'WF}c^7^:hE3hCHs^3UV _@;    ?O7 ?O7?O70@  MC+N/]ON?2abu u??e!00!"//"!00!"//$$_dd #/! ! 4&#"326%4&#"3263267'#"'vu/"!00!"//"!00!"/2ba2?NOu u"//"!00!"//"!00_dd_$!FU/;3!!#&&''&&'!5!66776674#"32LfX"4I&P|9bkLpP3BD P BE0$e\$,-U?G5_J`]E2H9 Q>=3TjEjT9F=,-I '!!#!5!"&&546632"3254&&5;4gv~~n;I;yzzyoT&#"&&5432'"3254&&$93NXh v~~TfEK25yzzy:"#"&'!726'#"&54766766!lJ\N1K-TZ!-0IClE`a]c %%__[I;R6S73!!7676654'#"&54632&&5463267632#"&'&'J6Qg=[t^"#"3o|rvt3FG)rmYb(tx=3%X=)?&&'&'&&5463267632bsy.)mnQ=&!>?J4194@ 4g4+N+++M?99107!525h&$/@H+ 0 H++]5+]5#)5@OO\\``@9o$'$$ 4 n {3!{@-' $o**{@%`00$$@$o$$$7`+`  @ o6|+NM]]]9/N]M]]9/??+] -k+N]MqD&?ƯE`v̽~Q,grv ^!3c*)ZQ7qx}PTQ`i *6@A(YY-V/V3Y5ii-f/f3i5 6w;5;/33KEJ/D3   5@ $ & " 4 3 (*4 #%4 144 @ 4`  _t&.t 4t )@ "1)&"<88 4  3+!X7+q?99??99?r+++++9/9/]9?3/]3/3/10]q]q!546673326655#"&&5325!# &5432654&#")xf&J8Ada ~Â`ĀXtqbzxpvZt{_9;^'k5W]Gp}*e6+@  @ 4)++5Y56Kb@  @4)++5@/    %  @)@P`p 0 0]22//33//]qr]22//33//?3/?3/9/]9/3///33//10#535!!5!3#!!!!5'E''E<ĺ<Z@54EDXh@4_@ 4t@  & @ $4   <@"$4p&@ $4?qr+<<<]qr+qr+?hn;6,@ @4)++5o6@ @5)++5^6,i@ @4)++5^6@ @5)++5QX6,@  @4)++5R6@  @5)++5nQ+@Z   4244#%4@4@P`p @- 0n]qr9/]qr]qr+++9/+??3/?10]!327#"&547! 6Q#@ @/+]qr5ht@9HUi w@%4 - -' @  0]<]q9/3????2/3/+10]]!6!2#"'7326&#"!& ZVzY\DTHq6E'mƄLV> @ ' t@$ &@ $4<""@"$4""p""")&@ $4?!qr+]qr+qr+22/3/?/3/3/3/??10]]732654&&#"!!632#"R34"6+WBF|${?'PoPasIW&kήmY62i@  @4)++5R6R@ @5)++5YX62@ # @ 4)++5R6R@ !@5)++5[65@ """&@$/+]5*[7>6U@ @/+]5Je66V@ -0@-4)++506V@ +.@+5)++5, @) % /?Pp0-@  0-@Pp+N]KQX@8YM]<<]NEeD]9/9/??M<9/<<10!5!!5!!!!!:MN:(! 4@`@ tt@  / /_@&U?`@ 4 x+N+qrK7SK;QZX8YM<<<<]3/3/??<<9/]<<]q10+3#327#"&&55#535#535%3#'"'Jb|l%^n3&*V9Ӥ$;68@ ( @4)++5S6X@ % @5)++5$68i@  @4)++5S6X@  @5)++5$X68@ ! @4)++5S6X@  @5)++5Q$#@4#Y YWc"""" " % o 4  @ %@%P%`%p%% %0%%% 0$]]qr9/3/+]?3/?3/?10q]q]327#"&547.!32665!2J)yz\~ !)5@$4IFIFFIYVVYg h  @ 4 `   {@$$f33((f{@--f  `"!*o&!@ 0o**@ `  ˵`00@ 4k7o@ 0`pM6]]+]]q]]]999999?!@ HoBB@8`88˵`HH2 42kO+]]q]]]9999]]qqr+]]9/?D4@ )4f{@ )55fDD.99f${@>>f. )+1`!!3!@ o;;@1`11˶+o''7!`AA+@ 4+kHo`  ˵xG2/]3/999]+]]]q]]9?]]9/]99?)65@ @ 5)++555$b%@" J?__4@F4 GUY   % 0c<]9?3Z @q GV i z       t % %ly    0   ]2/]2/9]?2/?2/=9/]q3/.+}ć.+}10r]q!!!!mv{^<,7X<S;V#u@/- @8   0 @ _    0@_ 0]2/q]<<2/q]??<<9/<<10]!!>5!!&$&5V('s:'djMWxUb@e   g dkh %%- Oo @` ' 4 @ '0]3/+3/3/]3/]33??2/<2/10]]]35!! !!5654#"bvFCxaȭ<z?濹?l6,;@  @4)++55X6<E;@  @ 4)++55N6.L@ $$@$5)++5N60@ ##@ 5)++5lV6@ @5)++5G6@ @5)++5l<6#x@ @5)++555l)k@8!H!W'g g' ))t#t@   )))@ &! A+&?*<3/9/3???9/9310]q]$32#"'6654&#"32654&#6hԷӎsQFc"/SPllD:өn鏰v[SgU҈xw]l^& @  @ 4@!&   & @>   9  @ P  &@P9O_ ]3/]q2/]q9??@47DGt@  &@ $4<@"$4p) & @ $4   ?qr+]qr+qr+????10]]!4&&#"!!632VUBOv#{?lsHZ&jNg@"HHGZZTTllddw t@ o tt@ !A!X<<??9/]q10q]q !"&&#"!326*$]UT^s]UU] W&9@`@ 4 &!$4?+??10+q]3!&g& @ UVeftv=(-9Iki @7:4@/24@(*4   &  &   4 4  & !"4 ? +<+2/+99?<D^ @%   h @ 4 @&4` &   &   @?    9@P &  @ P  9O_ ]3/]q2/]q9??Rvl>n@2 4   8HZVVZiffi tt@ ! A& 4+<??3?10]]+%!463 #"32654&#"]0ՍsqyiA+D  NQ>"r@!7GX\v     tt!t@ ! A$!X#9/33/3/?3/2/?23/10]]&#"#"'732654&'&&54$32:qaDz;:T8?UKhܩ/$͋[i*351.54 v2&@ jjyyt@  & @ $4 @ 4   ?@"$4p& 4@ $4<qr++]qr+qr++?5!!.5v'lUVj'SU&}L_L~~̖vNu&'@ " tt@C" !%!)A! o &   o  !%X(2/q]92/q]3/q3/q?<3?<9/10!32665!32654'!#"'#"54 uP7SU6TqD? 8__`_&ᤌDdgBchDr2].Cm6@  @5)++55v26#@  @5)++55R6R@ @5)++5v26#@  @5)++5Nu6&@ )+ @+5)++56(_,@  @ 4)++55/GX 4@! 4-0- %0- 0-@ '  0  ]]<]9/3?Z@ @4)++5l' N@ %  @  /   %/ 0 ]3/q]2/q]/?(l=F$da4@4%%%'  @ 0 0]<]]3//?9/q]10++!!!2#!%!26654&#!HؙŶL( pSPؑN`Ff]b%8% 4@4c 0]++??10!!!G<Q@17 G g % %  % 0  % /3/3/]3/]3//.5GH-WX- @ '++@,-,,--',0#C# e@ C,D e 9e:"+,@:4040)&0960!+0-'",/F?FFc ! D""::,^E2/2/<<2/3/]99]++/<<<-\Lf-n{6i:~8k< -eM^.?@ap,&@Xh FI 4e@ _o@$4%-?O_-  "'' 4 @(  ']3/+3/39/?2/]3/]?2/+3/]|9/+910]q]%! !"$'%32654&##532654&#"f]xxC*fC"um*Cfi@2YNyNZnzePn' @ F04@!44;O />?4[]4@'ST42@[]4@ST42@ @ P ` p   0 []4@ ST42 0   ]++2/]]qr]++2/?qS; ;@ %   % 0    ]3/]3/?(z<<@}E@hh%   @  0]<??<9/10]]!3267!!#"$5}(|x_6(ZToR)(xFN()p S@ %  @  /   @  / 0   ]q]q]?°ѣnx0*@v !  X ee } yy   9I   \z %`% @!! !0!p!,' 0 ]q]]<]99?<D\)@9g#g%h)HGZU#U%Z)h' 7 887H 't@Pt!t@ $!A+`+p+! @:5 X*2/+q3/3/??]q3/q?]210]]]q]3#"'#"6632#"$!3232654&#" s$k>ň"n^;ޑiqli;utE~NW& @88I  $   @ @$&4   @ !!  A"&@ $4?!]qr+<]3/3??9/]r+910]q!2#!32654&##32654&##ggNnlcumxn~&YX|mBGC9B:KN;U&>t @ 4&@ $4?qr+3/+]??10!!!L&& t  t@  &  t 4 4 @" 4 {@EH4@4?&t 0/]3/3/]3/]q+++++3/]?<H-1G@"&'(*).678*9.-*--4@%4--1,-,,, 4,&+*++*@4&( -*@ 0#@Y +, (((I(s((,-*(+1  F |   3@ 43l+0###++++1&/3/3/]<<2/]3/q+9q]9]q?<<<%1\{r҅$=8)e% #m+RCNF~T+m# 3R<;>&@&W g v @#@$&4@024_/K @  K   @@4#!A( O(   @4 @ 4/+]3/+]]3/+39/?2/]?2/]9/]rq++910]]526654&#"'6632# %32654&#IB;II8X$$[bvuU>O_cPI/2U0Z3Sm/ a|)/S8>G^& v@FI7GQ_@$ &@ $4< & $4 ? +2/]+2/?&NFv,,m"% 3]5;&Dж 4t t@ &<&o  ]2/q???10q+!!!#"'523265TfqCn &,9&B#.Kd& @ 4   4@ 44@ 4 4@ 4 4 4@  @      $4<@@!$4@!$4  $4 ? +3/+]3/++9999?<<R7&Ct@ &@ $4< &@ $4?qr+qr+?SU?>F&Dt@  @ 4  4& 4+++??<10!!!!&CQR&\Tl)5@D  1%,15 g&g(h,h.f4 X Wghh h#0t $t *tt@%)7A3!''&--!!X6]<2/<2/]????<333310]]]qq!6632#"&'!#"5432"32654&"32654&3[K8=NQ6NumQRr|NVlsOOrhOOKJJK>8LL?ɗȈ `&[& Y t@ & t@ 4H & @ $4   ? qr+]+3/]?@W X XWg h hg @+/@4@4 KOt K4t@ ! A&&@ 4i+3/9/?+?]9/++]qr10]!&&#"%!2# %3267!+ lb>oebg#cpm|{@@3'Q3>@4 404@%4hhjjeeXXZZUUtt  t@!! A!&@ $4? rq+<9/]<????9/10]]]++++!36$32#"'#!"32654& kܱ uksullu&Sfcғʋ!&@#'   b r   @4 &    @8      &@ $4< !@ '4Xrq+3/]rq+<93q?<4@4XW WXhf fh @+/@4@4 KOtK4t@ &&A! @ 4 i+3/9/?+?]9/++]qr10]++!327!"43 &&#"!pc#gbeo>bl +€3" +3@@{|0>VLp6@  @5)++55QMs&"@ 4' t "@O@4 t& @&4_    !A$@$ &o#]2/q]9/]qr+<??9/+]q?10]+!2#!!#"'53265!!2654&##v{9] -{FYm0j?+ޞ8JP7:M&@&& t@  @, & o@_!A&?q<9/rq]<<?<?<9/r]<<10]q!!!!!!!2#%!2654&##Fdf[xB&{{@xBEL9Y@%64FD  Xh_  t@1  &@ $4<p&@ $4?qr+<<3/<3/]qrqr+?S=It t_ 4i &@ $4?qr++]??3/103!!qN&&A|#0@}@ 0p/3/]/]105!A~ "&@B !7!IE!  !!!1@2  @ @4#t@&& 2 ##@   $$ 4@ (/(2 4 '+2/]+2/q3/q]q3/9/q]2/?<3/2/+]3/?<99.+]}10]q]!!!!4632#"&%32654&#"!!"A߬Z>>A@;;CD58FRpu__vvbby0& Q  t@ &Oɳ@ 4{ &@ɲ ]q+q]q?<M:RrW%Gikf1G4 A  ?3/?10+q!!6324&#"f!fzW:!|ͫ; 71w@  (JGg{w   ٲ3/q9/???<10]qq632!5!54&#"!7673tFW\x2@1,$BHѧ`h%!A ??10!%CK1Q@     Ե 2/3/?3/?10]q]q!!5!4&#"'632'na:NyʽxUP= x@?  hhff  7GXXVVA  ??10q]]]432#"%32654&#"P.!vvu 6/ b%@-'$ 'FDw 4  @   @  q2/q3/9/22?<<<.+}10]q+]%667!'67!qD Y#u+}*dhC1r@!h  *  ״ A  9/?3/?/]108]q]q327#"&&563 !4&#"lv/GTeBi蟡?NQd%h̓db7!@,9;;JMM v״ ײ ҵ# !!4!"+q3/3/9/3/?3/?2/9/2/910]q]63 !"'732654&#"327#"&&5Kݷ7Ҫ8:u/GTN^3C: {8 h% x@  W d vvw   @ 0A  9/]9?/5B,DD"*I51Lt"izBR 48BpYol3IJ24IJ~^`%5nr/?10!!$%Fv4 @274',44274IKI@P.I  KI  >>#3/3/?]KQXY/]10+++++4764763[,S2\,S.+%P+(#>0+%P+(#Fv/:$4.-/4/@-/4$'% -93 I@ 444"$4 3AG@-J#I  @ % )9504 #"@ %/4 )@4)#5@45-/450# </3/+++9/+93/+9999?9/++++q9/999910r+++'#67654&#"6763267&'&5476324&#"6V.:GW(  ."&E?'+5&G %A"  /)C6$B % #F7B*/ //4&U&FT $&4$&4@ ',44 @274',44274I  K I@P.IKI >>#3/3/?]KQXY/]10++++++++%4764764Z,S4Z,ST/,#Q,(";/-#R+*#FvEG@ ',44274IKI > #3/?]10+++4762\)VE.+%Q-'#Hv)(@$4  '!I 4),4H 44  @ '$@4"$@4$-/4$#@ *&3/+++9999?<+++]999910]+'##6767&'&54632'4&#"6S2J2I5G@!M-*  K& ,$27H83'Be8()7 ]."FT=4274IKI> #3/?]10++%4764Z,ST0,#P+("Fv(4@ "4@4 !&A M!K@4MK    % &&*3/3/9/q?+99/+10++#"&'#"&546773276773276573 #** +  &dK06 $ 922 $ #8K1 2(+/FvQ @ 4 #4@ $*4 $*4 @ 014 -/4 I 44K !@ 4  #73/3/]+?2/++10++++++#"&546324&#"326Q\C66P;6Jb<6MwZWD-# O  @ 4 /?@4 @4 _/3/]9/+9/+/]3/+9/9/10&&'6767" d\R $X%+6j5>G|&>hK"P,@G   0@  O9/]33//9/??9/10]#4&'&&'(>-%Xa|V$)I(k~2n;D%Z4@ 4g@   / 0@  9/3//9//3/9??3/9/9/]]10]++#4&'.'3253Zj% 8_]i`LrN:Z:pd@ mS "g@@4"# /"/@##@ 4# 04 # '&9/33/9//+3/9/99/??3/<9/9/+]9/+910q]+++#"&'#4&'&&'326533273+5$%6;$6WhdmDL87JK66N7NO65JHGz6LL66ON0"K@ 4 4F  @  3/]q9/2/3/?3/+3/+10'6765&'&54632&;"J*E)1%)K69VUI;9!777-( $<6MP:dgs@ww00wxQQ# 4 @* 4Y 4B 4,9ak*# q;F`UTGYBNkoqpkoN&@ 4 4\ 4? 4G@# "4 #4GTFUn`a\ h9,*;?&3onohp@ n0nnnut9/]999++++++/999++++10qq#"''#"'#"&5467'#"&54767&'#"&5463267&'&546327&'&5463267632676324&#"326d,!5JJ vV%4j  ! !$"!.0$VqC!;+!+*",k3=E\4"9S,`HA +n[ZB3)H.6#F ׹ts'!^zx ,ipE5F%1"A8%#@at 4n 404~Y@#4] #1@0%8O/]3/]33//39/2??2/+9/q9/++10+]]467&54676632&&#"32767x&qDW6<%AXGRWa'=4*2@8?Qv!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ Fv98@ 44 @ 274',4@ ',44274+ "4IKI@P.I  KI@ @ 4 P@ .#@4##.27A M2K@.4.M)K >>  # ""-- .6 77;#3/3/9/q3/q3/?+99/+KRX@Y+]KQXY/]10++++++++476476#"&'#"&5476773276773276573[,S2\,S3! #)++   &.+%P+(#>0+%P+(#L06 " 91$$ #8K1 2)-1!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ %,5nr/?10!!,,%!!%!! @ !!%!! @ !!%!! @ tx!)-$4(4'@4#4$4 4x+C--$(#%CO''u#C@)lS A T  n,*4**"&$$"((&@ 4A,3r/ $*4t.+9/3/9/+??<KRX@Y]992/10]++++++!"&'&&54676673!&'&'7''77'7xyO.Rj *58+I;#q>/ZKhTnPfd%j)A,AXK(O\-9[ L &;kYN5JfPe`txtr ε44@4 44C COu C@lA T  n4  &@ 4,3r/+9/3/9/+??KRX@Y]992/10+++++!!&'&'7''77'7r 7PK7hTnPfd%D/@UKJfPe`tr!!!%!! @ !!%!! @ !!%!! @ !!%!! @ 4`8&*%4$@4 4!4@"4+;Tf&!4(C**!% "CO$$u&C  by dYc)'4''#!!@%%,< w 6v+3/2/99]9/3/9/+?2//2/9/q]992/10+]q]+++++ '&47"!23!2763''77'7~w[!u02.P3/2/99]9/9/+]++3/++9/+++?2//2/]?99]9/+]q++2/+++992/+10++]q]++++++#"&54767!27 47#"!23"33''77'7Ⰰ 䌐WC_`ÿ]yz-?%Q<;*8-^X~H]yDVU%f?:K5 )eP#?t  0 G6?WDRtv!4@444Y4C!!COuC@l a A xn 4@ 4@4 4 r#/9/99+++]9/3/9/+?<2/KQXY]992/10+]++++!!&'&#"6632''77'7vyg[W+)7VBzL<*NjP(AJ1FtdPfJPl+o%T2@4 485,"S@ %b$ 11n2@@4%%4+@ "4+@ 4+A;8@2r4$ * 5"/++3/9/3/+?2/?9/]3/2/10]q+]+"'&54673!&'&'&'&'&54767676767"_U9E<'t'%398 Y2A:B4V(Ob:TGaBmD%JB]|*MK*`G/#(,,$X9Je):-(!#2 " E^No%NF@>;4G1W1: 4(6D##$$ Hcsv'&' @S@ ?? @4  b@ 33 +,n7 @ 4 2@333@ "4@ 4A;@,rH?$ @*C5<"/++9/]9/3/+?<<9]?9/q3/+9]3/10q]]+]q+2767654&'&'&5476767676733#"'&'&'!!"'&54673\l7V.6D)#M8A7]Kk`ak{NlYAuc1JBK\KO*Dnv_U9E<'55P#I?Ie):-&*")$%!'* F4o_"4A5W.XSYJB]|*MK*`G%(%@85   b %%n@ @4 '@ "4@ 4;8r'/++3/9/3/+?2/?9/]3/10]q]!!&'&'&'&'&54767676767"('%398 Y2A:B4V(Ob:TGaBmD%/#(,,$X9Je):-(!#2 " E^N%9@7G3W3(6%%&& Hcsv)()  "" @4  b@ 55 -.n @ 4 2@555"@ "4"@ 4"A ;.r; /++9/]9/3/+?<<9]?9/q3/+9]10q]]]q32767654&'&'&5476767676733#"'&'&'!l7V.6D)#M8A7]Kk`ak{NlYAuc1JBK\KO*Dnv%5P#I?Ie):-&*")$%!'* F4o_"4A5W.XSYo%T2>@ 4<< 485,"99\8P3`33`@4Q$S@ %b$ 11n28(@44%@4%%@+@ "4+@ 4+A;8@2r@$ * 5"/++3/9/3/+<?2/?9/]3/2/KQXY]KQXYq10]q+]]+"'&54673!&'&'&'&'&54767676767"567676_U9E<'t'%398 Y2A:B4V(Ob:TGaBmDWםU"Uco%JB]|*MK*`G/#(,,$X9Je):-(!#2 " E^NOJD9":C66*>...  & ''3#3/3/9/q3/q3/?]KQXY]KQXY9+9/+10+++++++++#"&'#"&5476773276773276574764763! #**+   &4Y+T3Z+T}L05 "81$$ !8I1 2)-,.,#R,)"#/-$Q+)#FvX1 4$&4@ ',44274# "4IKI@@ 4P@ .@4&*/A M*K@ &4&M!K > %% &1. //113#3/3/9/q3/q?+99/+KRX@Y+]10++++++476#"&'#"&5476773276773276574Y-R3! #**+  &X..#P*)"K06 " 82$$ #8L1 2),1@v JVH#4-/4<@ "4TNS@),4H@ @ 4 @H.4@444,?(CHA MCK@%?4?M:K, @TQK@4#Q@4Q-/4QK#@ /!4 33/>((> ?!G HH!!X3/3/9/q9/+++9999?+99/+KRX@Y2/++999910+++"'&'#"&'6767&'&54632#"&'#"&547677327677327657'4&#"66#'#9<8L0: G-/   3! #**+   &Q#  1& "!+U)# K06 " 82$$ #8K2 2)-1( Fvr)14/@ ',414,274@ "4@44MK@ "'A M"K@P.*I,,K0I. *>...  & ''3#3/3/9/q3/q?]KQXY9+9/+10+++++#"&'#"&5476773276773276574763 #**+  &3Z,SK/5 " 82# $ !7J1 2),1/-$P+(#!!%!! @ !!%!! @ ///10#!$HbGQ$///105!#QHG !@   /<//<10###!!!HrG !@   ///10!!5!###rHGS@ ////<]10###!H @@  @4   /9=/<<//<+9=/<<<10#'77'$Hb ׶yyx #@    ///103#5!3###HGG)@     ///103#5!#3###HGGG !@   ///<10!!!##HFHS///<10#!$H,l@ /9=///<10##$HSW$'@ /<<//9/9/10##$HHH'88W' @   ///1053#5!#3WGBGGGW'///10#Hnw W$'@ ///10]#'$H'0W'///103!$'wG-?#/@D # # 5 5**G> >@2$$G5>5>!055 >>''G@ 55 >>--G+?]]NM]]10]]'766327'#"&''7&&54632654&#"5m89n42m;8l4wSTvvTTv3m:9m44m99kTvvTTvv #.48DHLRY`h@wz&S%c%#%3%C%Y=i=)=9=I=YAiA)A9AIAV;f;&;6;F;VCfC&C6CFCfhbdV`f`Y[i[**c*****u***3*C*S*cBB(-Wo]?]O]_]]]'VP(/(?(O((/ OGG23/3g<^P''O'_'' '0'@''R F"OM7K R6JMap999@9P9`999'W0^^'''_'o'@f''''$U-e-%-5-E--S++_oZP$$o!6 5## ! #j0eeo??????O??IJN/MMN1EQ2FN/]/]qr]q]]]q3]]]qr]]]/<<<<]]q]/<<<<]]q9/qq910]]q]]qq]]]]]]]]]]]]]]q]]#5#5!!5!#3#"'73253!5!!5353!#32##!!5!#"&54632#3!5!!334##324##32%#"32dCC?ddV4I(_tC~dYwdC~CddCdYeo|~ddd~C-Od?d ĺ[6.C?d{C~ddCcm !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ S0HC@g  q;@ 0%/]q<3/3//3//3/10]&'&'&4767670,h3g9JJ:f5d.l8<"8-}N౞Sy*KgSH:@hq ;%3/<2/2//3//3/10]'6767654'&'7I8h2j,M8"<8l.b6e;KSᮞM-L*vU!!%!! @ .J\.pz @4RbbJXJaJr?rq??Mgff@ nmnnmYXX@ a`aa`MQRR@ ?M??MY@@@ 4$@ 4$',M'K@ $ 4$M K@`fgnmadYX`RQ8U5qr?CFFxC``QmmQr\MMx@QQUn<xdCCC$G.>4, /.  ", - ,QPH AIBJMZ#8%4kx6"!96#~783h"a -CL/ z "DRX )*$WP+6IES 3)A+ QK6"G0439!$2G!Zr?!.3%E-4(_K;D92&:5<.9FK/.g=.BXDl@~^`"@ &7[j`@ @/4 4 a@  4c61@/$   ;/q3]q23/3/]9///q9/+9+9/+10]q'4767&&54632&&#"66`Pc\M2a<"B^888c-a4*;0IF:D4  % A@ 2 `  7H;G+{* 7lc}5CRfr}I, ,$a.EilZi  B$ !W  6082,MX(@44))  ( @ 4W JGг,-4I*+4I@')4C@/;4C@ &4CC-E@)-4EH=|@ 2L54L54-G1{4G22@7B4"""" 4cS,nK5-I"8@')48@ 4882@@@-z@ 22$$$5@rO$ 8:/3/3/2/]9/3/2/q9/++99?2/?+9/]9+3/99+/+9/+++++10q]+]q++#"#"&5476732$54&#"547676633667&&5467632&#"32ۅ-'3Q'%3>8/ZKyxx%j)A,AXK(O\-9[ L &;kYN~rxrr  D@lT  n  4 &@ 4,3r/+9/+9/9/??KRX@Y9/9/10!!&'&'7'7r 7PK7fxx%D/@U(~rr6n)@46F!  4@444C@uC@"'@4@ 4R@ @?O@ 4` 'n@""$ +7@ @ +3@ @*+4@ 4$4/9/++]3/]9q9q9/3/?/]+q++93/]9910++++]r]q+''77#"&5467'6674&'326C@5%2PfJ<{'L:6lZRx.-:'->mx+eC ./@%-<%@4jj 44@444!/.""'((@ ""C@uC@@ 4(-"'!./:d:@ 40:p::::/\@ ?!!!'' -n@'"('@ 4''877<r>/]9/+9993/3/??]9/]2/]q+9/99992/+]99.+}ć<<10+++++]]+''77#"'&'&'#"''&&54767677&&546733'326nPhW$:(6D&7%zN$@&F5#-`%*{ 7!F"0PfJ)MjT#3"+) &sU4"%x  %x@)ٹ44@444  4x C@uC@%S$A T % n 4%&$@ 4$A, 3r+$*4t*+9/+3/??<3/]9910]++++++''77!"&'&&54676673!&'&'7nPhTyO.Rj *58+I;#q>/ZKPfJj)A,AXK(O\-9[ L &;kYN%x@%r44@444C@uC@ @@ 4A T  n0 &@ 4, 3r /+9/]3/??3/+]9910+++++''77!!&'&'7bnPhT 7PK7RPfJmD/@U%r&x! ' 4 4 @444 4xC  C@u C@"S+!A T " n  4  "&!@ 4!A,3 r)$*4t(+9/+3/9/??3/]992/10]++++++'7''77!"&'&&54673!&&'7Sdf|nPhT4289I8*%5X(!# dPfJ *,R^u$VY)aWGGB7@slh&x!%r Ĺ 4 4 @444C  C@u C@ @@ 4A T  n 0  &@ 4,3 r /+9/]3/9/??3/+]992/10+++++'7''77!!&'&'7df|nPhT 7PK7?dPfJmD/@U%r4`8"@"4+;Tf& !!"D@ @ 4 by dYc ""!@P,< w 6v#3/2/99]9/]9/9/?2//2/9/+9/9/10]q]+ '&47"!23!2763'7~w[!u02.P<*NjP(AJ1FtPlPl@ 4D@ Z@ o]@ V   4. $1r 2//3/+9/9/?/]2/3/9/9/10+]'7#"'&'73267654'&'xw^hJXeX*Zn@Ew $48DJz=JR2+><*NjP(AJ1FtPl~x>@ " &"  4@ 4%14,,%;4;4n%n@S V  ~ /,,1(2/'-4/@ 4///7 &,2@$/$$$$$$;;774A4@r@$ +5/2/9/9/]]33/]++99/9//?9/?3//+9/99+10+]]"&'##!"$5476732654&'326546774&54677xn^:[[*.zxNDkG\(%!A 7[$h ?gM~x%$9ƹ@45  6@ 4+.&&646.nn 0@ )&&+!2)'-4)@4)))16611.4r;/2/9/3/]++99/9/9/]2/?<<3//+9/99+9/3/9]10]+"&'##"&'##32765332765476774&547677$pH:[[CN7D:QiF[BF-{z4? &%\32U% #)FQT$;M R23D")p A 7["ls?gM%$~x1 J @ 4 .&. 4 @4444C  C@u C@8@ 41=@881G4G@n 1n@S+A V , %~@  0 ;88=42;'-4;@ 4;;;C,&+,(2@0/000000GG CC@A4@ rL$ +"5/2/9/9/]]33/]++99/9/9/]3/9//?9/?3//+9/99+3/]992/10+]++++]+'7''77"&'##!"$5476732654&'326546774&54677ddf|nPhTn^:[[*.zxNDkG\(%!A 7[$h ?gM~x1%$1 E; 4 @444 44AC  C@u C@2""!!B@ 4)7:22)B4B:n )n "0@ !!!5227-25'-45@4555=BB ==:4 rG/2/9/3/]++99/9/9/]2/9/3/9/?<<3//+9/99+9/3/9]3/]992/10]++++++'7''77"&'##"&'##32765332765476774&547677df|nWhT*pH:[[CN7D:QiF[BF-{z4? &%\32UdPfJ #)FQT$;M R23D")p A 7["ls?gM%$1~,5@ $ 4&2x%%4*4*@ 4?000d((4n@ S V  ~3 -&,2@ /-A7@r7 $ +5/9/]399/?9/?zj=jT!B;O[ &:Uq~%r#-@ 4W*x!4!@ 4@4,?(((d ,n @ +$0@ @ 4 $7r/ /9/+]33//99?<<(?-,O\ -Uq%r}~09@ ( 4 !&!6x))  4.4.@ 4D@ ?444d,,#8n@S V  ~ 7$1#&,2@ #/### 1A7@r;$ +5 /9/]3999/9/9//?9/?zj=jT!B;O[ &:Uq}~%r'1@ 4W.x %4%@ 4@4D@#0?,,,d##0n @ /(0@ @ 4 (7r3 /9/+]33//999/9/9/?<<(?-,O\ -Uq%r%v-6ĵ 4+@ 4 & @ 4   }@ #?111d))5n@&4.@ 46 6  ?#6 .7r8 /9/]93/3/q3/99]9/+99?F~p!92H1+ҏV`Mpz9Q4t0&J  [f|b;5::8>Jc%$"@ x"e@""  R@ _`/ n@" .@ $ 7//3/3/9/99?/]]2/]9/]9]9/]10]##32767&&54632&&#"$piMNZl2"oe]+*O]D|[sS-' K]:IDa$/E%( #@IVw @4@4@ 4# n @.pr% /3/]/999/]/]?<<9/++3/+99910q]q#"&'##3267&'&#"'463233(Ox%AhEQiiSC9  ,}*:0%@GP!;m_3]P4^H5* : @ 4iD@ #4#@ 4 4 #***~&4&&3^Y553n@@ 4 #&**&&5579@4-4 @ 4 /+3/+3/3/9/9/3/999/+]9/9/?2//9/+]99+++3/q9/9/10]+]'7 $54767&&54676632"&'"667!3267Wxyf',a2LV*"On@6,4t#v;7Hzr`9/9/+3e_B6**22F~p!92H1+ҏV`Mpz9Q4t0z5&J  [f|b;5::8>Jc%$f&@ x&D@ e@&&  R@ _  `/ n @@@ 4&$.@ ($7 //3/3/9/992/+]9/9/?/]]2/]9/]9]9/]3/q9/9/10]'7##32767&&54632&&#"xzpiMNZl2"oe]+*O]D|[szS-' K]:IDa$/E%( '@IVwD@ #@4@4@ 4'n @_@4@ 4# .p  r) /3/]/999/]3/++]9/9//]?<<9/++3/+9993/9/9/10q]q'7#"&'##3267&'&#"'463233'xzOx%AhEQiiSC9  ,}*:0z@GP!;m_3]PuV<&/+.@ 4(4.@4(4v  4!4#@4  4( D"R"',4'-.4''*d" en&n@ 4&0 *5@ ?@#49-4-4-(,4--'8r1z2/++++r2/3/+9/9/?2//9/++9/3/9/9/108++++]++++'7#"#"'&546736$3&&547632'&&#"xx8ކT_X,PBHQZݙ")W^qj0+#.%VzKFrOg-2 1/b>6uV<%$@  4(4@4D@l@  0"@""b@@ 4@ 4n@ @ 4 6@ /@ 42r&z/2/+]999/+9/9/?/]+9/+]99/KQXY9/9/10]+++'7!!4'&'#"&547632'&&#"326%xsJX l=PnHOQi)0%/PzYW%9*>BjPv/%6$%<4@4GV244@!#4 !#4*D@P@@(/4o/e@0 n@@ 4 @46@ 446rz+2/++9/9/+9/9/?2/3/]/]]qr+KQXY9/9/10]q++++]q++'7!32&&54632'&&#"|xyK".)nwYe$X,z !mhxV`+Qm,D.9.4 @44%44@444),),C@uC@ @*4@ 4*d@ 2@4227S* 7n#~ @@ !4@4&$ 6/!&5@555@ 4551r;z2/+]q99/]3/9/++3//]?9/3/+++]9910]++++++++''77! $5476732$54&'#"&547632'&&#"326nPhT,S.3<[M<i3n|JPbl?:8'TPfJBx*Vzf  nd|>4Bm,D%(44@444 4(4@4C@uC@  0&@&&b@@ 4 @ 4  n 6@ /###@ 4## 2r* z/2/+]999/3/?/]+9/+]99/]]9910]++++++++''77!!4'&'#"&547632'&&#"326CnPhT)JX l=PnHOQi)0%/ZPfJeW%9*>BjPv/%6$%>!+4 4 @ 4G!V!!4@444244@!#4!#4*C@uC@@!4@ 4@(/4o/e@0 n@ @46@ 446r#z+2/++9/9/]3/?2/3/]/]]qr+3/++]9910]q++++++++]q+++''77!32&&54632'&&#"anPhT3".)nwYe$X,PfJ !mhxV`+Qo%2!D]@ 4%0 4&4322@ DCDDCL 4^@ 4H 42+S*@ 4**823C4??844B}8D2n"3@`p@ 4@4 7@04.4*$ +*.5@''8@488?C3B2/44B  4B4B??DrF$2/33/+/]9999/+/]9/+q33/++/]q9/?2Wa_U9E<'y@7.*%Q #$m @7% TNB{ ++2\.)=6 #9>lz*uU[cn'^$b("VJJ q#i0%&2@ } n@ @4 o/  4r$/2/33/+/]q9999/+?(x^DT23e!/F9,2:p(DgN(r%#t@ 44a@@&/4@!4" "n n 3@ 4`p:r% /2/]+2/?3/93/++10++"'&'##3276767632'4'&#"32i}_:U)GZ5D9YO73KO+0#'4Q &)$1W ERIT6z0W~%xwD@ T  n 4 & @ 4 ,3r/+3/+9/9/??3/9/9/10'7!!&'&'7xxy 7PK7fzCD/@U%xXn&!@%6F  @4 @ 4 R@ @?O@ 4` n@  +  7@ @ #3@ @*+4@ 44 /9/++]3/]9q9q?/]+q++910]r]q#"&5467'6674&'326nnfZN\/=$:b@:R>C@5%2<{'L:6lZRx.-:'->mx+eC ./@%%4@jj4'& @ %&'2 d2@ 402p2222'\? %n@ @ 48//<r6/]9/+999??9/]2/]q+9/9999.+}ć<<10+]]#"'&'&'#"''&&54767677&&546733'326$:(6D&7%zN$@&F5#-`%*{ 7!F"0%MjT#3"+) &sU4"%x  v,6@).I.i.y.6F3@ 43);#K##  4#05 55fn @ @!430405 -'5@  -4o8 /3/]9/]9/+99/3/+39/?3/]/]9+]9910+]q#"'&'##326754767'667%4&#"6764&'32v#0*apyC^JMZZE"&J0 }sv-\ !W?7IWj(.L; $yZe.$Q\Ui39!(* {;02:H2z)2;1س&41س41@ 4jz66س 4/@&4 '868/::4:d77f@P----000%))n%!03$44*7474*8!!38r=/9/3/9/+9/++99?<<22/]3/]33//+]10]q++]+++#"#"5#3276776326633%4&#"664'&'320/$$" *H8Z68?oUK?3% .2dIx3h&E1sW*@MX%)',@}Y% -udVTtRZ* Lqy(982<XLn$ 4@4 &X h yz @ 4 4@4?Z@  @ 4 _?Od.P6!!5r&2/2//]/]/+2/?]3/]310+++]q]++#"&'732767#"&547632&#"3܎S*lE9Ha_px*cuEK`PpxV%OAjj:H6@oښ71$/Ln?@0 4&7:G:W9+@ (454"R!!=3_@@$(4/_o'@ 4b= @ '@ 4'@ 4'` 57704@ @A!$ ""%3/3/3/33//3//++?2/+9/q+9/10++]]+&&#"32272# 476732676767654&#"'&54676632$%#6&9m$(2_wo#'~.JJPJ0>c-a4*;0IF:D 7H;G+{* 7lc}5CRfr}I, ,$a.EilZB1@ 4&  U  !!" 4.@ 4&4&&cS1n@ )))#5r3@$ +5/3/2/]9/?2//9/+9]10++]]+#"#"&547673276654&#"&546767633%-b!el&.8^Fvhp,j>'BZeP% &(7>0>B,2t*\\j'#c 6x P8?r?GL@0 4&7:G:W9+@(454BFAEDDCE@@G@A4AAE@C@ 40CCC"R!!=3_@@$(4/_o'@ 4b= @ '@ 4'@ 4'`@@ 4AA@CCBDGG@FEEDDDFF@@@BB 57704@ @I!$ ""%3/3/3/33//3/9/]3/]=9/9/9/9//+q++?2/+9/q+9//]+3/+=9/9/9910++]]+&&#"32272# 476732676767654&#"'&54676632''77$%#6&9m$(2_wo#'~.JJPJ0>c-a4*;0IF:DJJLJ 7H;G+{* 7lc}5CRfr}I, ,$a.EilZوNRN0N,4(@44))  ( @ 4W /3.1120--4?..2?0@7B4"""" 4cS,n@..-00/144-32231//-@333$$$5@r6$ 8/3/3/2/]9/9/]3/9/9/9/9/?2/?+9/]9+?3/9/9/9910]+]q++#"#"&5476732$54&#"547676633''77ۅ-'3Q'%3> ,/4>.= A&& @ 288@ AAO nZ@"4O4ZODPPDA=>.   #42259.@*88555`p\&&##O######4#(/+]qr33//]3/q33//]3/9/9/9/]9/3/99++?3/]9/3/?3/9/99?]3/]99+3/++10]+++++]q+'#667&'&'#"'.546326765&&5467'66#"&'&&#"'63232674H8>7 reWFr4*BB;@! 'wfP?3.b- $*~0,/;LA,R<"A.',.<$?)H ,.LFGOvrc.%6 (4GW;0?!)%:{6*p``EE=UPo!<|D@pJ1)*1( M  7N>@E4FUgJH4H@ #4>$(4>444N4NKC@4CFHAKH@;; 0 o "Z 7nN@4C4NC8DD8 +!@"4@!`!!!!0!P!!!!4+002..+7224444rP(3/+3/2/9/9//]q+3/9/]9//3/99++?23/?]3//3/9/3/++10++++++]q]+&&'#"'&'&&5432#"'&5!'56676767654&'4733#"&'&&#"'6323267<;aPV&&;gΏ?8,R<"A.',.<$?)H ,.3)3+'9=8'/HaWgnb_@1g/S[k]WDЫæC1( M "<Cdb@()4C)-C"*4^()4^*-4^@'5Z@/;4Z@ &4ZZD\@)-4\HT|@ IcL&4cLKDGH{KG@(I@(4I@ 4II&> *04>.= A&&& @ 288@ AAO ncLDa"O@')4O@ 4OOIWWDzII#A@*,4A=>.   #42259.@88555pf&&?#O##:/q33//]3/q33//]3/9/9/9/]9+3/2/9/++99?3/]9/3/?3/9/99?]3/]99+3/++99+/+9/++++10]++]q+'#667&'&'#"'.546326765&&5467'66667&&5467632&#"32H8>7 reWFr4*BB;@! 'wfP?3.b- $*~0,/;LA  % A@ 2 ` LFGOvrc.%6 (4GW;0?!)%:{6*p``EE=UPo!<|D@pJ1)*  B$ !W  67XS@FUgVJ44RR*-4S@'(4N@/;4N@ &4NNPW@&4W@?8G<{?G=P@)-4PHH|@=@&4=@ 4==  0 o "Z 7nW@8T"C@')4C@ 4CC=KK8z@== +!4+002..+7224444rZ:3/+3/2/9/9//3/9/]9/2/2/9/++99?23/?]3//3/]9/3/+++99+/9/++++10r++]qr]&&'#"'&'&&5432#"'&5!'56676767654&'4733667&&5467632&#"32;aPV&&;gΏ?8  % A@ 2 ` 3)3+'9=8'/HaWgnb_@1g/S[k]WDЫæ.  B$ !W  6" <Cd@ C)-C"*4_)-4_@'(4Z@/;4Z@ &4ZZ\cL&4cLKDGH{KGI|\@)-4\H@TQ@> *04>.= A&& @ 288@ AAO ncLD`"O@')4O@ 4OOIWWWDz@ I@4IIIA@*,4A=>.   #42259.@88555pf&&?#O##:/q33//]3/q33//]3/9/9/9/]9+3/]+2/q9/++99?3/]9/3/?3/9/99?]3/]99+KQXY+99+/9/++++10]+]q'#667&'&'#"'.546326765&&5467'66667&&5467632&#"32H8>7 reWFr4*BB;@! 'wfP?3.b- $*~0,/;LA  % A@ 2 ` LFGOvrc.%6 (4GW;0?!)%:{6*p``EE=UPo!<|D@pJ1)*  B$ !W  6  7X9@FUgJ44R)-4R@'(4N@/;4N@ &4NNPW@&4W@?8G<{?G=|P@)-4PH@HH  0 o "Z 7nW@8T"C@')4C@ 4CC=KK8z@==! +!4+002..+7224444rZ:3/+3/2/9/9//3/9/]9/3/2/9/++99?23/?]3//3/9/3/+99+/9/++++10++]q]&&'#"'&'&&5432#"'&5!'56676767654&'4733667&&5467632&#"32;aPV&&;gΏ?8  % A@ 2 ` 3)3+'9=8'/HaWgnb_@1g/S[k]WDЫæX  B$ !W  6"<C@ C)-C@"*4> *04>.= A&& @ 288@ AAO nA@*,4A=>.   #42259.@88555pE&&?#O## /q33//]3/q33//]3/9/9/9/]9+?3/]9/3/?3/9/99?]3/]99+10]+]q'#667&'&'#"'.546326765&&5467'66H8>7 reWFr4*BB;@! 'wfP?3.b- $*~0,/;LALFGOvrc.%6 (4GW;0?!)%:{6*p``EE=UPo!<|D@pJ1)* 7@FUgJ4@4 0 o "Z 7n@ +!4+002..+7224444r93/+3/2/9/9//3/9/]9/?23/?]3//3/9/10++]q]&&'#"'&'&&5432#"'&5!'56676767654&'4733;aPV&&;gΏ?83)3+'9=8'/HaWgnb_@1g/S[k]WDЫæ!!%!! @ !!%!! @ FvEFv!!%!! @ !!%!! @ !!%!! @ FvQFv!!%!! @ !!%!! @ Hv)Fv!!%!! @ !!%!! @ !!%!! @ FvXIFvFvrKFmH@vJ0vG!!%!! @ FTFT!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ GAQk/ /2/9/?KQXY/?108#4'&'&54632#"&54632+9 %F79IH42HH42HCv~:~-=]\72HH23JJ"  F/?10#"&54632O76LM58N6ON76ONW )A F F /3/?/10#"&54632#"&54632N85LJ78NO75LK68N8NN87NN6ON76ON!!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ !!%!! @ %F5nr/?10!!FF%%F5nr/?10!!FF%%E5nr/?10!!EE%Y)@A&e$f%wxwu FF  $! @/&?&&&)8 -"- '&&6&&@?5 00@@@2 4(@4(r/)?))@4)& 0p+'0*]q3/]+]+9/+]qr+33]???2/]10]]q]327654'&#"!! 76! 67#smlqnjkp0+rV̸ADu/u򈀀|~|m >Cl\pѾz5R>,@;4'#'""#'hgg hg'XWW XW(@ /))),8 t%t !)@N 4P`+@4+r,,,@4,@ 4,&0`/_.! `  >?4 X-+r3/q]++q+9/rq]+3???2/]10q]]]]+327654'&#"!#"'&&547663267#rKGrrFKKFrrGK%+:Ct|EHYTTYXTTYz|7A%~BF5'޳44 @5R ZTg  % @""@ 4""'8  !@-4!!!p!!P!!!'&@4&r/'?''@4'&@ 4)  0 P(rq]3/+]+]+9/rq]+<?<<2/+]?10]q+++]!! '&'&5!32765!6767#+9\A?( ) (9"|7XrkMMU}6DzK+N.[&%׹4@4   4/ I L@o  %8 t@ &P@454@K5@" 4%@ 4%@4%%%&$@4$r@ 4'&` $4?&+qr3/+r+q++9/+++rq<9/???<<2/]10]r+]++!!5#"'&5!32665!6767#+:Y}P& -)?Gs*8"&|7VVU@0 NvL.[93@^@;B4@574@*34@"4_o@ 4@4@4@;B4@4@4@./4_a@@./4@4@ 4n4/++++q]q+++/++++]qr/++++]qr10#%!DZ;r3@^@;B4@574@*34@"4_o@ 4@4@4@;B4@4@4@./4_a@@./4@4@ 4n4/++++q]q+++/++++]qr/++++]qr10#%!r;_ $#T$4@ 4_Y@ 4a@ n/]]]?]q]q10++#!$; 13@G@;B4@574@*34@"4_o@ 4@4@4@;B444@ ./4Pa./44@  4n@4/++++q]q+++/++++]qr/++++]qr107!1y;a3@G@;B4@574@*34@"4_o@ 4@4@4@;B444@ ./4Pa./44@  4n@4/++++q]q+++/++++]qr/++++]qr107!y;U #R@ 4 $4_Y@ 4a@n 0/]]]?]q]q10++!U; &?w@@& 4@P / ? O  -/4@ 4 p 4/+]3/2/++|/]q}]qr+107676'&#"'6#55*[? 'i{NVpd !f'*Kh2n?@g@ "4/@AB4@;>4@574@*34@"4 >   @AB4 @;>4 @094 @"4 @4 @ 4 "4@  4 /3/2/++/++++++]r2//+++++]qr9/+107676'&#"'6#51'T: $b]  AED ,?w@@& 4@P / ? O  -/4@ 4 p 4/+]3/2/++|/]q}]qr+107676'&#"'6#55*[? 'i{NVpd !f'*Kh2ni?@g@ "4/@AB4@;>4@574@*34@"4 >   @AB4 @;>4 @094 @"4 @4 @ 4 "4@  4 /3/2/++/++++++]r2//+++++]qr9/+107676'&#"'6#51'T: $b]  AED ,I30e 4 4 @ nn 4@ E   E4 4/++]2/]?3/3/]2/108++&6323273#"'&#"q[>k;#= ?gCNIf~6W8$_~:@IYx &)4 !/4s@7 @L5@AB4@;>4@574034@*/4@#4 @!/4s@8@9>4@/34@4@ 44    /2/]+q/++++]+3//+++++++]q3/+108+]qq&6323273#"'&#"q[>kM#= p?gX@ Ce,F,Lp R 4 @ nn 4@ E   EO/q2/]?]q3/3/]2/108+&6323273#"'&#"qq[>k;#= ?gCN f~6W8$_n @4'' '' @= ?O@P5@E5@@B4@674@.34@4@4@4@ 4@n*/4@5@W5@S5@OP4@L5@HI4@DE4@@B4@<>4@5:4@.34@!"4/O_ @")4 Z @")4Z/rq+2/+/]qr+++++++++++++/+++++++++]qr1088qr+&'3327673#"'&a*@AC@$aIMp#v: 8$&3n@4?/O@P5@E5@@B4@;>4@674@.34@4@4@4@ 4@5@W5@S5@OP4@L5@HI4@DE4@@B4@<>4@5:4@.34@!"4/O_& ))&@$74@&4 @$74@@&4 /++++3]q3]q/]qr++++++++++++/++++++++++]qr9+10#73#nڲ6JoH/?80C4@(4P 0&4/+qr]/rq++]10!ox&*@dkk"d%#  @ @ 4'@ ((( #?@! 4! )) ,''/3/3/<<33//9/9/9?3/+]3/]9/3/]9/+<<9910]#53533##5#"'&547632327654#"5!NNZV\YT}[!/VG,/I,/7IIm~glgbgw5M:>n7<\ 6'@W g h W(W1G(G1w . 4 @%(4 `   {@4"&o!!!.:54&{@34 0 /!")@ "4/?`@0o**$`0@ 40k8o@ 0`pM7]]+]]]]qqr+9/9999?;S%!.1cFJ},Hp@"24145WghWW'GG'w$ 4@%(4`H/{@$><<;@ 4;9>*o$ :5 *{*  H@ 4H4@HPHH/`77BBO.o..m@k;#= ?gCNIf~6W8$_I0e 4 4 @ nn 4@ E   E4 4/++]2/]?3/3/]2/108++&6323273#"'&#"q[>k;#= ?gCNIf~6W8$_6I0e 4 4 @ nn 4@ E   E4 4/++]2/]?3/3/]2/108++&6323273#"'&#"7q[>k;#= ?gCNIf~6W8$_p$} 45)++]10; 45)++]10O 45)++]10o}.Tom}o}#o}o}U u#T$4@ 4_Y@ 4a@ n/]]]?]q]q10++#!; Y #R@ 4 $4_Y@ 4a@n 0/]]]?]q]q10++!Y; ~2 45)++]10o}4oM}Poi}Fo_}o}1>oW}o}b:oS}o}I&o?}:@IYx &)4 !/4s@7 @L5@AB4@;>4@574034@*/4@#4 @!/4s@8@9>4@/34@4@ 44    /2/]+q/++++]+3//+++++++]q3/+108+]qq&6323273#"'&#"q[>kM#= p?gX@ Ce,F,L/I0e 4 4 @ nn 4@ E   E4 4/++]2/]?3/3/]2/108++&6323273#"'&#"0q[>k;#= ?gCNIf~6W8$_<:@IYx &)4 !/4s@7 @L5@AB4@;>4@574034@*/4@#4 @!/4s@8@9>4@/34@4@ 44    /2/]+q/++++]+3//+++++++]q3/+108+]qq&6323273#"'&#"q[>kM#= p?gX@ Ce,F,LvI0e 4 4 @ nn 4@ E   E4 4/++]2/]?3/3/]2/108++&6323273#"'&#"wq[>k;#= ?gCNIf~6W8$_&>@4` &4 4/++q??10]q+3!&o&$}  @+5Io.>&D} 45)2@+5?&$t@ `@+r5I.&DJ@0G@GGGF@+]53&$'|q)'@ 4P` H+ @+5+]r+5I.#&D'^9@;;@!4;8H+8h+7@ 477_7777/]q+5+5++]53&$'|n@ H+ @+5+]5I.#&D'M6@(= =0=P==8H+8h+7@ 477_7777/]q+5+5+]5?&$'|u.%@#74%$@ @+5++5I.?&D'tO-@ NM45@8h+7@ 477_7777/]q+5+5+5:&$'|y@@ @+5+5I.&D'z~3@%:O::D45@8h+7@ 477_7777/]q+5+5+]5on&$'|}@@ @ 4)++5+5Io.&D'}@;<)2@8h+75)++5+53&$'{q0@' _  0  H+ @+5+]q5I.#&D'^P@$pBBBB`BBB>H+p;;0;;;;o@H+7@ 477_7777/]q+5+]qq5+]r53&$'{n(@_"o""o"""""H+ @+5+]qr5I.#&D'MJ@DDDDD>H+p;;0;;;;o@H+7@ 477_7777/]q+5+]qq5+]5?&$'{u.2@#7421 @ @+5++5I.?&D'tOI@UUUUT;3@p;;0;;;;o@H+7@ 477_7777/]q+5+]qq5+]5:&$'{y@) @ @+5+qr5I.&D'z~E@AAK;3@p;;0;;;;o@H+7@ 477_7777/]q+5+]qq5+q5on&$'{}@ !@ @4)++5+5Io.&D'}1@BC)2@p;;0;;;;oH+75)++]qq5+5o&(}   @+5Ao'>&H} @+5?&(t@   @+]5A'&H@@01@11110 @+]5 &(hV@  @ 4)++5A'&H@ +@5)++53&('|q)+@ 4P` H+ @+]5+]r+5A'#&H'T9@%%@"4%"H+" h'!@ 4!!_!!!!/]q+5+++]53&('|n@ H+ @+]5+]5A'#&H'C6@)' '0'P''"H+" h'!@ 4!!_!!!!/]q+5++]5?&('|u.&&@"74 &&%@ @+]5+]+5A'?&H'tE3@&?8887@" h'!@ 4!!_!!!!/]q+5++q5:&('|y!@0@@ @+]5+]5A'&H'z~3@&$O$$.@" h'!@ 4!!_!!!!/]q+5++]5on&('|}#@ @ @4)++]5+5Ao'&H'} @%&@" h'!5)+++5j?&,tD @+5]&8@ 4@+]+5o&,} @+5o&L}  @+5Yo&2}  @+5Ro>&R}>  @+5Y?&2t5@0000/@+]5R&R@ ..-@+]5Y3&2'|qr'$@ 4P$`$$$H+! @+5+]r+5R#&R' 9@""@"4"H+h' @ 4 _  /]q+5+++]5Y3&2'|nY@&&H+! @+5+]5R#&R' 6@)$ $0$P$$H+h' @ 4 _  /]q+5++]5Y?&2'|ut6@"7465 @! @+5++5R?&R' t1@$554@h' @ 4 _  /]q+5++]5Y:&2'|y@#- @! @+5+5R&R' z-@!!+@h' @ 4 _  /]q+5++5Yon&2'|}@$% @! @4)++5+5Ro&R' }>@"# @h'5)+++5Y9&jf@----"H+*4)++]q5R&k-!@0P0`000%2H+-5)++]q5Y9&jCf!@++/+++" H++4)++]q5R&kC!@...@ 4.% H+.5)+++]5Y?&jt5@>>>>=""@+]5R&k@ AA@%%@+]5Y &jV$@ */****"BH++4)++]q5R&k)@ .;%%@.5)++5Yo&j} +,@+5Ro>&k}> ./@+5o$&8}  @+5oS&&X}*  @+5$?&8t@ $$* @+]5S&X@ ++* @+]59&lkf%@+0+@+p++++H+(4)++]q5&m'1@!o))O)_)))) )P)`))6H+&5)++]]qr59&lCf,@))?)O)))@4)H+)4)+++]q5&mC@'''H+'5)++]q5?&lt@ 118 @+]5&m@ ::9@+]5 &lV@ )6!@)4)++5&m@ '4@'5)++5o&l} )*@+5o&&m}* '(@+5oX&<}}@   @+q5QR&&\}t@ @+q5X?&<t@ 0@+]q5QR&\L(@ C5(('@+r+5X &<|V@  @ 4)++5QR&\@ "@5)++5<6$i@  @4)++5I.6D@ 37@95)++5o<6,i@ @ 4)++5o6@ @ 5)++5Y<62i@  @"4)++5R6R@ @ 5)++5$<68i@  @ 4)++5S6X@  @5)++5$368 @ # @#/555+555S4&X'=@P"@w@ H'  45)+/+]q5++]5$468 @ # @#/555+555S4&X''aA@ @w@H'@44_@ 45)+/+]++5++5$468@ & @&/555+555S4&X'a>@ %$@w@H'%@4%@4_%%@ 4%5)+/+]++5++5$468@ # @#/555+555S4&X'CaB@0@w@H'@44_@ 45)+/+]++5++]53 t@R @LM4@034@"$4 @4@Ls4@=E4@.34@$,4@4@4@4@ 4/+]++++++++]<]+++</10!5!#53#53~z4 @/ 4@ 4@ 4@ 4 @LM4@034@"$4 @8 4@4@Ks4@=E4@.:4@$%4@4@4@4@ 4/+]++++r+++++<]+++</++++9910#7#53#53疇쌌~4 4 ܵ @4@ 4 @4 @#%4@ 4@4?@ 4 4 @ 4 @LM4@034@"$4 @9 4@4@Os4@=E4@.:4@$%4@4@4@4@ 4/+]++++r++++<+9<]+++</+++]+++++99+q910#537#'37#53ڜQǑؘıbb4 @ @ 4 @( 4@ 4@ 4 @LM4@034@"$4 @8 4@4@Ks4@=E4@.:4@$%4@4@4@4@ 4/+]++++r+++++<]+++</++++9910#53'#'3#53`ؘ'  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ .nullnonmarkingreturnmu1pi1OhmEurodmacron overscoremiddotAbreveabreveAogonekaogonekDcarondcaronDslashEogonekeogonekEcaronecaronLacutelacuteLcaronlcaronLdotldotNacutenacuteNcaronncaron Odblacute odblacuteRacuteracuteRcaronrcaronSacutesacuteTcedillatcedillaTcarontcaronUringuring Udblacute udblacuteZacutezacuteZdotzdotGammaThetaPhialphadeltaepsilonsigmatauphi underscoredbl exclamdbl nsuperiorpeseta arrowleftarrowup arrowright arrowdown arrowboth arrowupdn arrowupdnbse orthogonal intersection equivalencehouse revlogicalnot integraltp integralbtSF100000SF110000SF010000SF030000SF020000SF040000SF080000SF090000SF060000SF070000SF050000SF430000SF240000SF510000SF520000SF390000SF220000SF210000SF250000SF500000SF490000SF380000SF280000SF270000SF260000SF360000SF370000SF420000SF190000SF200000SF230000SF470000SF480000SF410000SF450000SF460000SF400000SF540000SF530000SF440000upblockdnblockblocklfblockrtblockltshadeshadedkshade filledbox filledrecttriaguptriagrttriagdntriaglfcircle invbullet invcircle smileface invsmilefacesunfemalemalespadeclubheartdiamond musicalnotemusicalnotedblIJij napostropheminutesecond afii61248 afii61289H22073H18543H18551H18533 openbulletAmacronamacron Ccircumflex ccircumflexCdotcdotEmacronemacronEbreveebreveEdotedot Gcircumflex gcircumflexGdotgdotGcedillagcedilla Hcircumflex hcircumflexHbarhbarItildeitildeImacronimacronIbreveibreveIogonekiogonek Jcircumflex jcircumflexKcedillakcedilla kgreenlandicLcedillalcedillaNcedillancedillaEngengOmacronomacronObreveobreveRcedillarcedilla Scircumflex scircumflexTbartbarUtildeutildeUmacronumacronUbreveubreveUogonekuogonek Wcircumflex wcircumflex Ycircumflex ycircumflexlongs Aringacute aringacuteAEacuteaeacute Oslashacute oslashacute anoteleiaWgravewgraveWacutewacute Wdieresis wdieresisYgraveygrave quotereversed radicalex afii08941 estimated oneeighth threeeighths fiveeighths seveneighths commaaccentundercommaaccenttonos dieresistonos Alphatonos EpsilontonosEtatonos Iotatonos Omicrontonos Upsilontonos OmegatonosiotadieresistonosAlphaBetaDeltaEpsilonZetaEtaIotaKappaLambdaMuNuXiOmicronPiRhoSigmaTauUpsilonChiPsi IotadieresisUpsilondieresis alphatonos epsilontonosetatonos iotatonosupsilondieresistonosbetagammazetaetathetaiotakappalambdanuxiomicronrhosigma1upsilonchipsiomega iotadieresisupsilondieresis omicrontonos upsilontonos omegatonos afii10023 afii10051 afii10052 afii10053 afii10054 afii10055 afii10056 afii10057 afii10058 afii10059 afii10060 afii10061 afii10062 afii10145 afii10017 afii10018 afii10019 afii10020 afii10021 afii10022 afii10024 afii10025 afii10026 afii10027 afii10028 afii10029 afii10030 afii10031 afii10032 afii10033 afii10034 afii10035 afii10036 afii10037 afii10038 afii10039 afii10040 afii10041 afii10042 afii10043 afii10044 afii10045 afii10046 afii10047 afii10048 afii10049 afii10065 afii10066 afii10067 afii10068 afii10069 afii10070 afii10072 afii10073 afii10074 afii10075 afii10076 afii10077 afii10078 afii10079 afii10080 afii10081 afii10082 afii10083 afii10084 afii10085 afii10086 afii10087 afii10088 afii10089 afii10090 afii10091 afii10092 afii10093 afii10094 afii10095 afii10096 afii10097 afii10071 afii10099 afii10100 afii10101 afii10102 afii10103 afii10104 afii10105 afii10106 afii10107 afii10108 afii10109 afii10110 afii10193 afii10050 afii10098 afii00208 afii61352sheva hatafsegol hatafpatah hatafqamatshiriqtseresegolpatahqamatsholamqubutsdageshmetegmaqafrafepaseqshindotsindotsofpasuqalefbetgimeldalethevavzayinhettetyodfinalkafkaflamedfinalmemmemfinalnunnunsamekhayinfinalpepe finaltsaditsadiqofreshshintav doublevavvavyod doubleyodgeresh gershayim newsheqelsign vavshindot finalkafshevafinalkafqamats lamedholamlamedholamdageshaltayin shinshindot shinsindotshindageshshindotshindageshsindot alefpatah alefqamats alefmapiq betdagesh gimeldagesh daletdageshhedagesh vavdagesh zayindagesh tetdagesh yoddageshfinalkafdagesh kafdagesh lameddagesh memdagesh nundagesh samekhdagesh finalpedageshpedagesh tsadidagesh qofdagesh reshdagesh shindageshtavdagesvavholambetrafekafrafeperafe aleflamedzerowidthnonjoinerzerowidthjoinerlefttorightmarkrighttoleftmark afii57388 afii57403 afii57407 afii57409 afii57440 afii57451 afii57452 afii57453 afii57454 afii57455 afii57456 afii57457 afii57458 afii57392 afii57393 afii57394 afii57395 afii57396 afii57397 afii57398 afii57399 afii57400 afii57401 afii57381 afii57461 afii63167 afii57459 afii57543 afii57534 afii57494 afii62843 afii62844 afii62845 afii64240 afii64241 afii63954 afii57382 afii64242 afii62881 afii57504 afii57369 afii57370 afii57371 afii57372 afii57373 afii57374 afii57375 afii57391 afii57471 afii57460 afii52258 afii57506 afii62958 afii62956 afii52957 afii57505 afii62889 afii62887 afii62888 afii57507 afii62961 afii62959 afii62960 afii57508 afii62962 afii57567 afii62964 afii52305 afii52306 afii57509 afii62967 afii62965 afii62966 afii57555 afii52364 afii63753 afii63754 afii63759 afii63763 afii63795 afii62891 afii63808 afii62938 afii63810 afii62942 afii62947 afii63813 afii63823 afii63824 afii63833 afii63844 afii62882 afii62883 afii62884 afii62885 afii62886 afii63846 afii63849uni202Auni202Buni202Duni202Euni202Cuni206Euni206F;uni206Auni206Buni206C;uni206DuniF00AuniF00BuniF00CuniF00DuniF00EuniFFFC afii63904 afii63905 afii63906 afii63908 afii63910 afii63912 afii62927 afii63941 afii62939 afii63943 afii62943 afii62946 afii63946 afii62951 afii63948 afii62953 afii63950 afii63951 afii63952 afii63953 afii63956 afii63958 afii63959 afii63960 afii63961 afii64046 afii64058 afii64059 afii64060 afii64061 afii62945 afii64184 afii52399 afii52400 afii62753 afii57411 afii62754 afii57412 afii62755 afii57413 afii62756 afii57414 afii62759 afii62757 afii62758 afii57415 afii62760 afii57416 afii62763 afii62761 afii62762 afii57417 afii62764 afii57418 afii62767 afii62765 afii62766 afii57419 afii62770 afii62768 afii62769 afii57420 afii62773 afii62771 afii62772 afii57421 afii62776 afii62774 afii62775 afii57422 afii62779 afii62777 afii62778 afii57423 afii62780 afii57424 afii62781 afii57425 afii62782 afii57426 afii62783 afii57427 afii62786 afii62784 afii62785 afii57428 afii62789 afii62787 afii62788 afii57429 afii62792 afii62790 afii62791 afii57430 afii62795 afii62793 afii62794 afii57431 afii62798 afii62796 afii62797 afii57432 afii62801 afii62799 afii62800 afii57433 afii62804 afii62802 afii62803 afii57434 afii62807 afii62805 afii62806 afii57441 afii62810 afii62808 afii62809 afii57442 afii62813 afii62811 afii62812 afii57443 afii62816 afii57410 afii62815 afii57444 afii62819 afii62817 afii62818 afii57445 afii62822 afii62820 afii62821 afii57446 afii62825 afii62823 afii62824 afii57447 afii62828 afii57470 afii62827 afii57448 afii62829 afii57449 afii62830 afii57450 afii62833 afii62831 afii62832 afii62834 afii62835 afii62836 afii62837 afii62838 afii62839 afii62840 afii62841 glyph1021 afii57543-2 afii57454-2 afii57451-2 glyph1025 glyph1026 afii57471-2 afii57458-2 afii57457-2 afii57494-2 afii57459-2 afii57455-2 afii57452-2 glyph1034 glyph1035 glyph1036 afii62884-2 afii62881-2 afii62886-2 afii62883-2 afii62885-2 afii62882-2 afii57504-2 afii57456-2 afii57453-2 glyph1046 glyph1047 afii57543-3 afii57454-3 afii57451-3 glyph1051 glyph1052 afii57471-3 afii57458-3 afii57457-3 afii57494-3 afii57459-3 afii57455-3 afii57452-3 glyph1060 glyph1061 glyph1062 afii62884-3 afii62881-3 afii62886-3 afii62883-3 afii62885-3 afii62882-3 afii57504-3 afii57456-3 afii57453-3 glyph1072 glyph1073 afii57543-4 afii57454-4 afii57451-4 glyph1077 glyph1078 afii57471-4 afii57458-4 afii57457-4 afii57494-4 afii57459-4 afii57455-4 afii57452-4 glyph1086 glyph1087 glyph1088 afii62884-4 afii62881-4 afii62886-4 afii62883-4 afii62885-4 afii62882-4 afii57504-4 afii57456-4 afii57453-4 glyph1098 glyph1099 glyph1100 glyph1101 glyph1102 glyph1103 glyph1104 glyph1105 glyph1106 glyph1107 glyph1108 glyph1109 glyph1110 glyph1111 glyph1112 glyph1113 glyph1114 glyph1115 glyph1116 glyph1117 glyph1118 glyph1119 glyph1120 glyph1121 glyph1122 glyph1123 glyph1124 glyph1125 glyph1126 afii57440-2 afii57440-3 afii57440-4OhornohornUhornuhornf006f007f009combininghookabovef010f013f011f01cf015combiningtildeaccentf02cdongsignonethird twothirdsf008f00ff012f014f016f017f018f019f01af01bf01ef01ff020f021f022combininggraveaccentcombiningacuteaccentf01dcombiningdotbelowf023f029f02af02bf024f025f026f027f028f02df02ef02ff030f031 Adotbelow adotbelow Ahookabove ahookaboveAcircumflexacuteacircumflexacuteAcircumflexgraveacircumflexgraveAcircumflexhookaboveacircumflexhookaboveAcircumflextildeacircumflextildeAcircumflexdotbelowacircumflexdotbelow Abreveacute abreveacute Abrevegrave abrevegraveAbrevehookaboveabrevehookabove Abrevetilde abrevetildeAbrevedotbelowabrevedotbelow Edotbelow edotbelow Ehookabove ehookaboveEtildeetildeEcircumflexacuteecircumflexacuteEcircumflexgraveecircumflexgraveEcircumflexhookaboveecircumflexhookaboveEcircumflextildeecircumflextildeEcircumflexdotbelowecircumflexdotbelow Ihookabove ihookabove Idotbelow idotbelow Odotbelow odotbelow Ohookabove ohookaboveOcircumflexacuteocircumflexacuteOcircumflexgraveocircumflexgraveOcircumflexhookaboveocircumflexhookaboveOcircumflextildeocircumflextildeOcircumflexdotbelowocircumflexdotbelow Ohornacute ohornacute Ohorngrave ohorngraveOhornhookaboveohornhookabove Ohorntilde ohorntilde Ohorndotbelow ohorndotbelow Udotbelow udotbelow Uhookabove uhookabove Uhornacute uhornacute Uhorngrave uhorngraveUhornhookaboveuhornhookabove Uhorntilde uhorntilde Uhorndotbelow uhorndotbelow Ydotbelow ydotbelow Yhookabove yhookaboveYtildeytildeuni01CDuni01CEuni01CFuni01D0uni01D1uni01D2uni01D3uni01D4uni01D5uni01D6uni01D7uni01D8uni01D9uni01DAuni01DBuni01DCV H$< $$7h$9h$:$L:E:H:I:K:L:M:N:Qd:W:Z:[:k:l:w;:;@;A;E;K;L;M;N;O;Q;T;W;Y;m<:<><@<A<E<H<K<L<M<N<O<Q<T<Y<l<o<q=======:=>=E=H=K=Z=\=^=_=b=e=f=g=h=j=m=u=v=x=y>A>M>N>Q>_>a3>h>m@A@H@K@L3@M3@Q@TL@Z@hA@AEAHAKALAMANAQAYDALDKDL3DM3DNDQ3DWDZDaDkEZ3FZFkFqH:H>H@HEHMHOHYH^HeJJJJJ:LJ>J@JAJEJFJHJKJLJMJNJOJYJZJ^J_JhJyK:K>KAKEKFKHKLKMKOKQKTKWKZK[K`KkKnKqL3LLLLL:L>L@3LELHLNLYLZL\L_LbLdLeLfLhLiLjLkLmLoLsLuLvLxLyMMMMMMM:fM>MEMHMNMWMYM[M\M]M^M_M`MaMbMcMdMeMfMgMhMiMjMkMoMpMrMsMxMyN:N>NENLNMNNNQNYNeOAOHOKONOWOhOmPZLP_PhSZT3TYVfV:V>V@VAVEVFVHVKVL1VOVQfVWVYW>W@WAWEWNWOWYW^W`WeX:X>X@XEXKXLXOXQX^X`XeZaZq[^[`[a[e[f[k[m[o[q[t[w[y\Z\[\_\`\e\f\h\k\l\m\n\q\t\y]L]3]^]e]h]k^a^k^m^t_[_`_f_k_l_m_o_q`Z`_`a`h`k`qaZa[a_a`aaaeafahakamanaqatdedhdkdndqdwe[e_ehekemeqfZf[fafhfkfmfnfwh^h`hahehfhkhlhmhohqhwhyj^j`jajejfjljmjojqjwjykZk[kokqktlflLl^l`lelhlklm3mfmLmmm3mZm^m_m`mamemfmhmjmkmlmnmomwmyn[n^n_nenfnhnlnmnqnyo[o_oaohokomonoqowpZpapksZshvlLvqLw[w^w`wawewfwkwlwowyx[x^x`xexfxkxlxoxqxwfLf./13 "&+M69&@M Arial Bd ?ARLB00@0 *H 010 *H 0` +7R0P0, +7<<<Obsolete>>>0 0 *H S[ ֟:a9?00)ъĽ5ǛSV0  *H 010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.0 970512070000Z 991231070000Z010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.00  *H 0. h|,-.  WSu3* [4 Z%}XsjxqX)X^-bXq"X/6MJ;"V~!lJGj6 -Ӵ90  *H :>{թy=q#+(ߌe,ZbVkbEƢ5"r-| CMlX 5ʉp*}a qfbB="2"d$006C!FXF%`0  *H 010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.0 970512070000Z 991231070000Z01'0%U VeriSign Time Stamping Service10U VeriSign Trust Network1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.10U VeriSign, Inc.10UInternet00  *H 0aGܴ^i b1FI:?xZcEO n06- o' Q`5OTOз,B Ѝ^㖴"IBlӘV.:X"e匫xGBh[-}0  *H m`_i{p+b#D Q#tI'\q5+ൖ苧KsH ڋ %VNGWF8V!&;-%2Λ@GmGv0;~*1+ݰUApF-,~0 0 yfnжneq0  *H 0a10UInternet10U VeriSign, Inc.1301U *VeriSign Commercial Software Publishers CA0 980416000000Z 990416235959Z0]10UInternet10U VeriSign, Inc.1301U *VeriSign Commercial Software Publishers CA1F0DU =www.verisign.com/repository/CPS Incorp. by Ref.,LIAB.LTD(c)961>0<U 5Digital ID Class 3 - Microsoft Software Validation v21 0 UUS10U Washington10URedmond10UMicrosoft Corporation10U Microsoft Corporation0 0  *H  0&dm{AO o*q.S26h5IؖeS zpm̳*02X|k%gw #1*0&0u0a10UInternet10U VeriSign, Inc.1301U *VeriSign Commercial Software Publishers CAyfnжneq0 *H 0 *H  1  +70 +7 10  +70 *H  1Tm?-)ytd!0X +7 1J0H Arial Bold font$"http://www.microsoft.com/truetype/0  *H qó06nX?~lhEw!MTIDZj 4`/'k:P0 *H  100010U VeriSign Trust Network10U VeriSign, Inc.1,0*U #VeriSign Time Stamping Service Root1402U +NO LIABILITY ACCEPTED, (c)97 VeriSign, Inc.C!FXF%`0 *H Y0 *H  1  *H 0 *H  1 981016201514Z0 *H  1}§MOV&K0  *H J2VT0> ^׳Ckk~wȃ؂SV倚00;z)0O6R8ouyu>稟o?{T >EA 2&en ܖ40e D燔   "'6GK|}  LNgi $Xarabinitmedi fina&liga, 6<!)/3'-1<"*04'-1`- (,.26-'+-15 X 6  & : &,GHIJKarab ghi endstream endobj 162 0 obj << /FHShade0 191 0 R /FHShade1 186 0 R /FHShade2 180 0 R /FHShade3 174 0 R /FHShade4 169 0 R /FHShade5 163 0 R >> endobj 163 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 655 0 0 0 13107 17694720 1 0 5 0 0 0 3932 0 0 0 6553 0 0 0 13107 13528 22546 44191 -65536 -65536 -65536 17255632 10 ] /Coords [ 1367 15259 1367 14789 ] /Function 164 0 R /ColorSpace /DeviceCMYK >> endobj 164 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.20642 0.34402 0.6743 ] /Functions [ 168 0 R 167 0 R 166 0 R 165 0 R ] >> endobj 165 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 166 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.2 ] >> endobj 167 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.06 ] /C1 [ 0 0 0 0.09999 ] >> endobj 168 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.00999 ] /C1 [ 0 0 0 0.06 ] >> endobj 169 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 13107 0 0 0 1310 17694720 0 0 4 0 0 0 13107 0 0 0 6553 51106 58020 -65536 -65536 -65536 17255632 ] /Coords [ 1208 14784 1208 14503 ] /Function 170 0 R /ColorSpace /DeviceCMYK >> endobj 170 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.77982 0.88531 ] /Functions [ 173 0 R 172 0 R 171 0 R ] >> endobj 171 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.01999 ] >> endobj 172 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.09999 ] >> endobj 173 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 174 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 0 0 0 0 13107 17694720 0 0 5 0 0 0 655 0 0 0 6553 0 0 0 13107 15933 44492 59523 -65536 -65536 -65536 17255632 10 ] /Coords [ 1608 14974 1608 14503 ] /Function 175 0 R /ColorSpace /DeviceCMYK >> endobj 175 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.24312 0.67889 0.90825 ] /Functions [ 179 0 R 178 0 R 177 0 R 176 0 R ] >> endobj 176 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.2 ] /C1 [ 0 0 0 0.2 ] >> endobj 177 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.09999 ] /C1 [ 0 0 0 0.2 ] >> endobj 178 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.00999 ] /C1 [ 0 0 0 0.09999 ] >> endobj 179 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0.00999 ] >> endobj 180 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 3276 0 0 0 65536 17694720 1 0 5 0 0 0 19660 0 0 0 32767 0 0 0 65536 13528 22546 44191 -65536 -65536 -65536 -1644092694 198102 ] /Coords [ 1367 15259 1367 14789 ] /Function 181 0 R /ColorSpace /DeviceCMYK >> endobj 181 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.20642 0.34402 0.6743 ] /Functions [ 185 0 R 184 0 R 183 0 R 182 0 R ] >> endobj 182 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 183 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 1 ] >> endobj 184 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.29999 ] /C1 [ 0 0 0 0.49998 ] >> endobj 185 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 0.5 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.29999 ] >> endobj 186 0 obj << /ShadingType 2 /FHGradSize 27 /FHGradStruct [ 8 0 0 0 65536 0 0 0 6553 17694720 0 0 4 0 0 0 65536 0 0 0 32767 51106 58020 -65536 -65536 -65536 -1644092694 ] /Coords [ 1208 14784 1208 14503 ] /Function 187 0 R /ColorSpace /DeviceCMYK >> endobj 187 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 ] /Bounds [ 0.77982 0.88531 ] /Functions [ 190 0 R 189 0 R 188 0 R ] >> endobj 188 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 0.09999 ] >> endobj 189 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 0.49998 ] >> endobj 190 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 191 0 obj << /ShadingType 2 /FHGradSize 33 /FHGradStruct [ 8 0 0 0 0 0 0 0 65536 17694720 0 0 5 0 0 0 3276 0 0 0 32767 0 0 0 65536 15933 44492 59523 -65536 -65536 -65536 -1644092694 198102 ] /Coords [ 1608 14974 1608 14503 ] /Function 192 0 R /ColorSpace /DeviceCMYK >> endobj 192 0 obj << /FunctionType 3 /Domain [ 0 1 ] /Encode [ 0 1 0 1 0 1 0 1 ] /Bounds [ 0.24312 0.67889 0.90825 ] /Functions [ 196 0 R 195 0 R 194 0 R 193 0 R ] >> endobj 193 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 1 ] /C1 [ 0 0 0 1 ] >> endobj 194 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.49998 ] /C1 [ 0 0 0 1 ] >> endobj 195 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0.04999 ] /C1 [ 0 0 0 0.49998 ] >> endobj 196 0 obj << /FunctionType 2 /Domain [ 0 1 ] /N 1 /C0 [ 0 0 0 0 ] /C1 [ 0 0 0 0.04999 ] >> endobj 197 0 obj [ ] endobj 198 1 obj << /Type /Metadata /Subtype /XML /Length 1322 >> stream 1998-07-01T15:06:56Z Acrobat Distiller 3.01 for Windows FELLS PageMaker 6.5 INSTALLATION ISS 2.P65 2003-05-13T10:14:45+01:00 1998-07-01T15:06:56Z FELLS INSTALLATION ISS 2.P65 2003-05-13T10:14:45+01:00 2003-05-13T10:14:45+01:00 FELLS INSTALLATION ISS 2.P65 endstream endobj 199 0 obj << /S /GoTo /D [ 92 0 R /Fit ] >> endobj xref 0 200 0000000000 65535 f 0000000016 00000 n 0000000102 00000 n 0000001226 00000 n 0000001377 00000 n 0000001481 00000 n 0000001590 00000 n 0000001667 00000 n 0000001743 00000 n 0000001906 00000 n 0000002021 00000 n 0000002110 00000 n 0000003346 00000 n 0000003510 00000 n 0000003617 00000 n 0000003723 00000 n 0000003812 00000 n 0000024668 00000 n 0000024880 00000 n 0000024985 00000 n 0000026064 00000 n 0000027140 00000 n 0000027217 00000 n 0000027293 00000 n 0000027382 00000 n 0000033704 00000 n 0000033892 00000 n 0000033981 00000 n 0000037806 00000 n 0000037970 00000 n 0000038061 00000 n 0000041863 00000 n 0000042039 00000 n 0000042148 00000 n 0000042239 00000 n 0000056578 00000 n 0000056789 00000 n 0000056880 00000 n 0000108549 00000 n 0000108771 00000 n 0000109846 00000 n 0000109937 00000 n 0000127265 00000 n 0000127548 00000 n 0000127869 00000 n 0000128190 00000 n 0000128508 00000 n 0000128586 00000 n 0000128629 00000 n 0000128720 00000 n 0000137513 00000 n 0000137777 00000 n 0000139002 00000 n 0000139317 00000 n 0000139407 00000 n 0000144635 00000 n 0000144801 00000 n 0000144909 00000 n 0000145027 00000 n 0000145117 00000 n 0000151298 00000 n 0000151496 00000 n 0000151588 00000 n 0000151678 00000 n 0000164027 00000 n 0000164204 00000 n 0000164315 00000 n 0000164405 00000 n 0000173107 00000 n 0000173318 00000 n 0000173408 00000 n 0000174371 00000 n 0000174523 00000 n 0000174604 00000 n 0000174685 00000 n 0000174766 00000 n 0000174847 00001 n 0000174901 00000 n 0000175375 00000 n 0000181218 00000 n 0000181569 00000 n 0000185671 00000 n 0000186061 00000 n 0000190338 00000 n 0000190693 00000 n 0000193469 00000 n 0000194889 00000 n 0000196306 00000 n 0000196407 00000 n 0000196520 00000 n 0000197916 00000 n 0000198035 00000 n 0000198248 00000 n 0000198403 00000 n 0000199939 00000 n 0000200020 00000 n 0000200081 00000 n 0000201184 00000 n 0000201395 00000 n 0000246479 00000 n 0000247807 00000 n 0000248008 00000 n 0000250102 00000 n 0000251207 00000 n 0000251419 00000 n 0000292432 00000 n 0000292613 00000 n 0000292893 00000 n 0000293065 00000 n 0000293170 00000 n 0000293279 00000 n 0000293389 00000 n 0000293499 00000 n 0000293753 00000 n 0000293906 00000 n 0000294005 00000 n 0000294107 00000 n 0000294211 00000 n 0000294472 00000 n 0000294625 00000 n 0000294736 00000 n 0000294843 00000 n 0000294946 00000 n 0000295223 00000 n 0000295396 00000 n 0000295499 00000 n 0000295606 00000 n 0000295717 00000 n 0000295822 00000 n 0000296097 00000 n 0000296269 00000 n 0000296370 00000 n 0000296477 00000 n 0000296590 00000 n 0000296703 00000 n 0000296951 00000 n 0000297104 00000 n 0000297203 00000 n 0000297308 00000 n 0000297413 00000 n 0000297668 00000 n 0000297821 00000 n 0000297932 00000 n 0000298037 00000 n 0000298136 00000 n 0000298407 00000 n 0000298580 00000 n 0000298679 00000 n 0000298784 00000 n 0000298895 00000 n 0000299000 00000 n 0000299023 00000 n 0000299134 00000 n 0000299271 00000 n 0000300922 00000 n 0000301031 00000 n 0000301071 00000 n 0000313148 00000 n 0000313212 00000 n 0000313329 00000 n 0000314441 00000 n 0000314647 00000 n 0000599281 00000 n 0000599420 00000 n 0000599700 00000 n 0000599872 00000 n 0000599977 00000 n 0000600086 00000 n 0000600196 00000 n 0000600306 00000 n 0000600567 00000 n 0000600720 00000 n 0000600831 00000 n 0000600938 00000 n 0000601041 00000 n 0000601318 00000 n 0000601491 00000 n 0000601594 00000 n 0000601701 00000 n 0000601812 00000 n 0000601917 00000 n 0000602208 00000 n 0000602380 00000 n 0000602481 00000 n 0000602588 00000 n 0000602701 00000 n 0000602814 00000 n 0000603079 00000 n 0000603232 00000 n 0000603343 00000 n 0000603448 00000 n 0000603547 00000 n 0000603834 00000 n 0000604007 00000 n 0000604106 00000 n 0000604211 00000 n 0000604322 00000 n 0000604427 00000 n 0000604450 00001 n 0000605858 00000 n trailer << /Size 200 /Info 91 0 R /Root 90 0 R /ID[<2bb66059178f0bf81cf0b2a76b6f73dd>] >> startxref 605913 %%EOF